Сп профилактика гриппа: ПРОФИЛАКТИКАГРИППА И ДРУГИХ ОСТРЫХ РЕСПИРАТОРНЫХ ВИРУСНЫХ ИНФЕКЦИЙ Санитарно-эпидемиологические правилаСП 3.1.2.3117-13

Разное

Содержание

Администрация Климовского района | Главная

 

пгт Климово

Статус: Городское поселение

Дата основания: 1708

Муниципальный район: Климовский район

(центр муницип.образ.): поселок Климово

Субъект Федерации: административный центр Климовского района, Брянская область

Население (чел.): 13297

Код ОКАТО: 15228551000

Глава пгт Климово:
Баранов Геннадий Николаевич

Адрес: 243040, Брянская обл., пос. Климово, ул. Щорса, д.1

Электронная почта: [email protected]

Муниципальное образование


пгт Климово

Статус: муниципальный район

Административный центр: поселок Климово

Субъект РФ: Брянская областьБрянская область

Федеральный округ: центральный

Экономический район: центральный

Состав:

15 муниципальных образований

Дата образования: 1929 год

Глава района:
Вазюля Иван Петрович

Глава администрации района:
Кубарев Сергей Владимирович

Адрес администрации: 243040 Россия, Брянская обл., пос.Климово, пл.Ленина, д.1

Телефон администрации: 8 (48347) 2-13-38

Лакомобудское


сельское поселение

Статус: сельское поселение

Состав: 5 населенных пунктов

Административный центр: с.Лакомая Буда

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 374

Глава поселения: Науменко Светлана Сергеевна

Адрес администрации: 243062 Россия, Брянская обл., Климовский район, с.Лакомая Буда, ул.Заречная, д.19-а

Телефон администрации: 8 (48347) 5-23-16

Электронная почта: [email protected]

Митьковское


сельское поселение

Статус: сельское поселение

Состав: 4 населенных пункта

Административный центр: с.Митьковка

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 934

Глава поселения: Письменный Владимир Васильевич

Адрес администрации: 243061 Россия, Брянская обл., Климовский район, с.Митьковка, ул.Советская, д.2

Телефон администрации: 8 (48347) 5-83-10

Электронная почта: [email protected]

Сытобудское


сельское поселение

Статус: сельское поселение

Состав: 4 населенных пункта

Административный центр: село Сытая Буда

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 715

Глава поселения: Скоблик Татьяна Викторовна

Адрес администрации: 243063 Россия, Брянская обл., Климовский район, с.Сытая Буда, ул.Школьная, д.11

Телефон администрации: 8 (48347) 5-89-10

Электронная почта: [email protected]

Плавенское


сельское поселение

Статус: сельское поселение

Состав: 10 населенных пунктов

Административный центр: село Плавна

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 923

Глава поселения: Сергиенко Ирина Анатольевна

Адрес администрации:

243070 Россия, Брянская обл., Климовский район, с.Плавна, ул.Центральная, д.12

Телефон администрации: 8 (48347) 5-13-91

Электронная почта: [email protected]

Истопское


сельское поселение

Статус: сельское поселение

Состав: 9 населенных пунктов

Административный центр: с. Истопки

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 1346

Глава поселения: Кривенкова Наталия Ивановна

Адрес администрации: 243071 Россия, Брянская обл., Климовский район, с.Истопки, ул. Октябрьская, д.21

Телефон администрации: 8 (48347) 5-27-22

Электронная почта: [email protected]

Сачковичское


сельское поселение

Статус: сельское поселение

Состав: 15 населенных пунктов

Административный центр: село Сачковичи

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 1701

Глава поселения: Конькова Людмила Михайловна

Адрес администрации: 243057 Россия, Брянская обл., Климовский район, с.Сачковичи, ул.Ленина, д.34

Телефон администрации: 8 (48347) 5-56-74

Электронная почта: adm-sachko[email protected]

Брахловское


сельское поселение

Статус: сельское поселение

Состав: 6 населенных пунктов

Административный центр: село Брахлов

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 584

Глава поселения: Пацук Анна Леонидовна

Адрес администрации: 243083 Россия, Брянская обл., Климовский район, с. Брахлов, ул. Цветная, д.2

Телефон администрации: 8 (48347) 5-55-60

Электронная почта: [email protected]

Новоропское


сельское поселение

Статус: сельское поселение

Состав: 10 населенных пунктов

Административный центр: село Новый Ропск

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 1549

Глава поселения: Балева Татьяна Ивановна

Адрес администрации: 243080 Россия, Брянская обл., Климовский район, с.Новый Ропск, ул.Ленина, д.148

Телефон администрации: 8 (48347) 5-96-94

Электронная почта: [email protected]

Челховское


сельское поселение

Статус:

сельское поселение

Состав: 10 населенных пунктов

Административный центр: село Чолхов

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 1231

Глава поселения: Шелест Елена Ивановна

Адрес администрации: 243076 Россия, Брянская обл., Климовский район, с.Чолхов, ул Молодежная, д.12

Телефон администрации: 8 (48347) 5-53-36<, 5-53-80/strong>

Электронная почта: [email protected]

Каменскохуторское


сельское поселение

Статус: сельское поселение

Состав: 9 населенных пунктов

Административный центр: с. Каменский Хутор

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 947

Глава поселения: Моховая Светлана Ивановна

Адрес администрации: 243063 Россия, Брянская обл., Климовский район, с. Каменский Хутор, ул Ленина, д. 99

Телефон администрации: 8 (48347) 5-16-32

Электронная почта: [email protected]

Чуровичское


сельское поселение

Статус: сельское поселение

Состав: 7 населенных пунктов

Административный центр: село Чуровичи

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 1316

Глава поселения: Житков Николай Николаевич

Адрес администрации: 243044 Россия, Брянская обл., Климовский район, с.Чуровичи, ул.Ленинская, д.102

Телефон администрации: 8 (48347) 5-37-38

Электронная почта: [email protected]

Кирилловское


сельское поселение

Статус: сельское поселение

Состав: 7 населенных пунктов

Административный центр: с.Кирилловка

Муниципальный район:

Климовский район

Субъект РФ: Брянская область

Население (чел.): 842

Глава поселения: Воскобойникова Ольга Викторовна

Адрес администрации: 243051 Россия, Брянская обл., Климовский район, с.Кирилловка, ул.Советская, д.34

Телефон администрации: 8 (48347) 5-35-24

Электронная почта: [email protected]

Хороменское


сельское поселение

Статус: сельское поселение

Состав: 3 населенных пункта

Административный центр: село Хоромное

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 583

Глава поселения: Неруш Александр Михайлович

Адрес администрации: 243067 Россия, Брянская обл., Климовский район, с.Хоромное, ул.Октябрьская, д.151

Телефон администрации: 8 (48347) 5-34-33

Электронная почта: [email protected]

Новоюрковичское


сельское поселение

Статус: сельское поселение

Состав: 14 населенных пунктов

Административный центр: село Новые Юрковичи

Муниципальный район: Климовский район

Субъект РФ: Брянская область

Население (чел.): 845

Глава поселения: Яковенко Наталья Владимировна

Адрес администрации: 243046 Россия, Брянская обл., Климовский район, с.Новые Юрковичи, ул.Советская, д.86

Телефон администрации: 8 (48347) 5-79-36

Электронная почта: [email protected]

Государственный


лесной фонд —

все леса на территории России независимо от видов собственности, их целевого назначения и использования. Землями государственного лесного фонда признаются земли, покрытые лесом, а также непокрытые лесом, но предоставленные для нужд лесного хозяйства.

В России четвертая волна коронавируса идет по португальскому сценарию. Что это значит?

В ряде регионов России для некоторых категорий граждан введена обязательная вакцинация от COVID-19, а также QR-коды для посещения людных мест. Такие вынужденные меры связаны, с одной стороны, с очередным рекордным ростом количества заразившихся новой коронавирусной инфекцией, а с другой — с громадной загрузкой медицинских учреждений, даже вновь открытых в последнее время. Но почему ситуацию в России довели до такой критической точки? Об этом корреспондент «Свободной прессы» Виталий Карюков побеседовал с научным сотрудником Института Общественных наук (ИОН) Российской академии народного хозяйства и государственной службы при Президенте РФ (РАНХиГС) антропологом Александрой Архиповой и экспертом по общественному здоровью, генеральным директором контрактно-исследовательской компании «КЭГ», иммунологом, кандидатом медицинских наук Николаем Крючковым.

Прививку от коронавируса в обязательном порядке необходимо будет сделать в целом списке областей, краев, крупных городов и целых республик. Речь идет не только о Московской и Ленинградской областях, но и достаточно большом перечне субъектов РФ и огромных регионах, начиная от Брянщины, Смоленщины, Вологодчины, Ярославской и Ивановской областей и заканчивая Забайкальем, Дальним Востоком, а также Якутией, Приморьем, и даже Сахалином, Камчаткой и Чукоткой. Обязательную вакцинацию предписано сделать, в первую очередь, тем, кто непосредственно работает и, соответственно, много общается с людьми: врачам, работникам культурно-спортивного сектора, всем, кто занят в сфере обслуживания — торговли и ресторанного бизнеса, а также в организации массовых мероприятий и прочим представителям профессий, связанных с пребыванием в общественных местах.

Но почему же ситуацию с вакцинированием довели до той критической точки, что количество заболевших коронавирусом стало уже бить антирекорды прошлого, самого тяжелого для россиян года, а также начала нынешнего сезона, принесшего уже третью, а потом и очередную четвертую волну заражения этой чумой ХХI века?

Дело здесь не в извечном национальном уповании на привычный русский авось. Тут и неверие в стремительность распространения коронавирусной инфекции, и отчасти недоверие к власти, которая призывает всеми правдами и неправдами пойти и сделать прививку, а выбор вакцины не всегда разнообразен. Но главное в том, что власти вовремя не позаботились о вакцинировании граждан, из-за чего, собственно, и происходит рост заболевания короной. Однако все имеет свою историю. Например, в конце прошлого века люди массово отказывались от прививки против полиомиелита, обосновывая это тем, что в обычной жизни они никогда с этой болезнью не столкнутся. Кроме того, и тогда, и сейчас бытовало мнение о том, что до конца неясно, к каким последствиям может привести вакцина, в которой могут содержаться тяжелые металлы и опасные вещества, способные проявиться через определенный промежуток времени. Было также и опасение, что вакцина может привести к аутизму. Хотя позже вся эта информация получила научное опровержение (это было опровергнуто не раз). Свою лепту внесли и слухи о том, что через вакцинацию людей могут чипировать. Это заблуждение существовало еще до возникновения пандемии коронавирусной инфекции. То, что творится сейчас — это свидетельство той потери доверия к власти и засилия годами складывающихся стереотипов, накопленных в обществе. Все это приводит к вере в мночисленные фейки о вреде прививок и вакцин, которые, впрочем, не подтверждены ни научными изысканиями, ни опытом, ни знаниями существа вопроса. Некоторые так называемые псевдонаучные «специалисты» просто хайпуют на теме здоровья, но ничего полезного сказать или предложить не могут, оперируя не знаниями, а слухами или непроверенной информацией.

«Сейчас творится примерно то же самое, когда противники вакцин говорят, что происходит вмешательство в ДНК, а люди, получившие прививку, изменяются на генном уровне, — рассказывает  Александра Архипова.

Немаловажную отрицательную роль сыграли и слухи о том, что большинство заболевших якобы были привиты «Спутником». И как спорить с людьми, утверждающими такое в соцсетях, но не обладающими фактическими данными — не совсем понятно. Ведь у фолловеров нет достаточного материала для дискуссии. Зато есть «знакомые врачи», которые могут запросто отговорить их и их друзей.

«Помимо недоверия к отечественному продукту, есть еще один магистральный фактор: огромное количество людей отговорили от прививки так называемые „знакомые врачи“. Структура доверия в России устроена так, что мы плохо доверяем медицине в целом, но хорошо доверяем знакомым врачам, — акцентирует внимание на этой проблеме Александра Архипова. — Мы сталкиваемся с таким эффектом: медицина в России сильно индивидуализирована. Врачи плохо следуют медицинским протоколам. Толковый осмысленный врач следит за исследованиями, а не очень толковый и грамотный говорит, что ему бог на душу положит».

«Кроме того, — продолжает Александра Сергеевна, — у нас действительно очень плохо развиты протоколы вакцинации для людей с разными заболеваниями: могут ли прививаться люди с такими-то аллергиями, такими-то болезнями. Врачу просто страшно брать ответственность за рекомендацию привиться. Он часто не знает, как именно вакцина отразится на заболевании его пациента. Гораздо проще сказать: не прививайтесь».

Но самое неприятное, по мнению известного антрополога, это то, что люди уверены: чиновники им врут про вакцины, не опасаясь наказание за свою ложь. Ведь за это, как они полагают, их нельзя привлечь к ответственности.

«Другая проблема — это слабая образованность населения в отношении своего собственного тела, — полагает Александра Сергеевна. — Многие люди не понимают, что такое вирус, как он работает и проникает в организм, что такое антитела. У такого человека, соответственно, понижена критичность восприятия в отношении любых слухов. И в итоге все эти факторы — недоверие к государству и государственной медицине, вера в „знакомых врачей“ и слабая образованность — становятся тремя слонами, на которых стоят российские конспирологические теории».

Вообще, большинство специалистов считает, что проблема изначально состояла в том, что если бы население начало вакцинироваться раньше, то и результаты были бы налицо. И таких осложнений мы бы могли избежать.

«На самом деле, начинать надо было еще в октябре-ноябре прошлого года. Если бы в некоторых крупных городах, включая Москву, ввели бы локдаун (хотя бы как весной), мы бы даже близко таких цифр избыточной смертности не получили бы», — уверен Николай Крючков.

«СП»: — Почему же тогда, на ваш взгляд, Россия опять бьет антирекорды по заражению ковидом? Хотя, казалось бы ситуация вроде бы выровнялась и даже болезнь на время отступила и случаи заражения пошли на убыль?

— Ну, я бы не сказал, что она выровнялась. Потому что мы даже после летней вспышки имели очень высокий уровень заболеваемости. И, даже по официальным данным, количество смертей оставалось в районе 800. То есть в принципе, это очень высокий показатель. Напомню, что в пике зимней волны 2020−2021 максимум был 550. Понятно, что там была коррекция статистическая (оперштабы), но всё равно это впечатляет. А это у нас уже был спад. А то, что происходит сейчас, это вполне предсказывалось, прогнозировалось, ничего тут удивительного нет. Масса проэпидемических фактов начала работать. Сейчас у нас основной штамм с начала лета — это Дельта и Дельта плюс. Соответственно, она гораздо более заразна, чем предыдущие. А до этого зимой и весной были ранние постуханьские штаммы. Потом пошло вперемешку с Альфой. Но всё равно заразность Дельты очень высокая. Свою роль сыграл и низкий темп вакцинации. Не в том смысле, что она как-то повредила, а в том, что она не достаточно помогла. То есть причина роста не в том, что вакцинация низкая. Это просто причина того, что вакцинация не сыграла определяющую роль в сдерживании в первую очередь тяжелого течения, госпитализации и смертности.

«СП»: — В связи с этим вопрос: неужели было необходимо действовать в административно-командном стиле и загнать население на вакцинацию принудительно?

— Ну, во-первых, никому не хочется действовать жёстко. Это не бизнес-интерес некоторых групп. Это не такой вопрос, который кому-то большую выгоду принесет. Тем более те вакцины, которые сейчас есть, все равно финансируются за счет государства. Понятно, что есть новые и коммерческие, но они пока еще не на рынке. Поэтому здесь такого интереса нет. Ну, во-первых, мы полностью принудительную масштабную вакцинацию провести не сможем. О чем, собственно, Владимир Путин и сказал. Второе — все-таки темпы выпуска вакцин еще недостаточны. Они далеко не феноменальны. То есть нам не хватит того, что мы выпускаем, чтобы быстро провести масштабную насильственную вакцинационную кампанию. И третья причина в том, что потеряна управляемость системой (она, в принципе, и не была особо управляемой) за счет очень резких и дерганых управленческих движений, когда сначала что-то вводится, потом без объяснения причин резко отменяется и так далее. Да, возможна обязательная вакцинация для определённых людей по профессиональному признаку. Это ЖКХ, транспорт, торговля, правоохранительные органы, работники систем здравоохранения и образования. Здесь подталкивание и умеренное давление возможно. Оно используется. И я думаю, это совершенно правильно. Но не исчерпан еще потенциал положительных мер. Почему-то мы на них поставили крест, а их, по большому счету, еще и не вводили. Ни бесплатные проездные, ни дисконтные карты не раздавали, ни какие-то льготы не давали (пусть временные).

«СП»: — Лотерея зато летом проводилась.

— Лотерея — это не то. Лотерея может быть в дополнение, но не вместо. Она, безусловно выгодна для государства. Но люди тоже не дураки. Они хотят гарантированно что-то получить. Поэтому мы очень сильно недоиспользовали потенциал положительных мер. Мы также ещё и давление нормально не использовали. Те цифры, которые вы видите, — это цифры оперштабов. Они во много раз занижены. По сравнению даже с официальными данными смертности от короновируса от Росстата примерно в два раза сейчас разнятся показатели — это огромная разница. Росстат официально сообщил. Все думают 200 тысяч. Никакие там не 200 — уже 430 тысяч. Это только официальный Росстат. А теперь избыточную смертность посмотрите, прогнозы по сезону — это огромные цифры. Они значительно выше, чем те, что озвучиваются. Я уж не говорю про госпитализации. Ущерб огромный на самом деле. С учетом этого, какие-то серьезные принудительные меры, например, локдауны, мы ввести не можем. Мы это уже показали. На региональный уровень спустили ответственность. И вакцинацию мы не можем принудительно сделать. Вот кто хочет, тот вакцинируется. Но мы видим очень низкий темп. Что делать тогда? Получается, мы говорим, что тогда делать нечего, никаких мер мы принять не можем. Соответственно, пусть умирают тогда. Хотим побить рекорд прошлого зимнего сезона? Мы его побьем вообще без проблем. Это уже гарантировано практически.

«СП»: — Может, стоит ли взять на вооружение опыт Израиля, где вакцинация носит тотальный характер?

— Стоит, но невозможно. У нас очень сильное антивакционное настроение. У нас другая ситуация, да и страна гораздо больше. Там просто желающих не вакцинироваться по сравнению с Россией очень мало. Я бы даже не про Израиль говорил, а про Португалию. Там цифры значительно выше Израиля. И это достаточно европейская страна. В среднем образована, но не прямо чтобы очень. И население сопоставимо с Израилем. Похожие вещи. Посмотрите, насколько они были успешны и за счет чего. Там много интересного. Я думаю, этот кейс будет еще обсуждаться.

«СП»: — А как вы считаете, могли бы предотвратить такое развитие событий, если бы вакцинацию действительно начали раньше?

— Безусловно. О чем мы и говорили. На самом деле, начинать серьезно надо было осенью прошлого года. Но умершие не входят в электорат. Они никого не интересуют. Ну, я условно говорю. А так, конечно, можно было раньше (и нужно было раньше) принимать меры. Но это же надо раскошеливаться. Надо денежки платить людям и компаниям частично возмещать. А этого тоже никто делать не хочет.

«СП»: — Каковы варианты дальнейшего развития событий, как считаете?

— Я думаю, что сейчас в зависимости от тех региональных мер, которые принимаются, будет продолжение роста, который в лучшем случае закончится к концу октября. А рост смертности закончится к середине ноября. Это лучший сценарий. Потом, соответственно, у нас будет медленный спад, потом какая-то стабилизация все равно на высоких цифрах и потом опять мы пойдем в рост где-то ближе к концу декабря, в начале января. А стабилизация с учетом коллективного иммунитета будет скорее к концу весны следующего года. Там будет уже серьезная стабилизация. Вопрос с чем мы придем к этому? С каким количеством умерших и постковидников. Все равно эпидемия закончится рано или поздно. Вопрос, с каким счетом? Сейчас очень плохой счет для России.

«СП»: — Ревакцинироваться все же стоит?

— Стоит. Сейчас вышли дополнительные публикации. По Израилю большая вышла. Это как минимум не вредит, а как максимум — очень сильно помогает. Судя по всему, довольно заметно помогает нам.

закроются ли школы и вузы по всей стране

Москва, 14.10.2021, 10:45:13, редакция FTimes.ru, автор Татьяна Орлонская.

Новая волна коронавирусной инфекции этой осенью, которая наблюдается по всей территории страны, привела к коррективам в привычную жизнь граждан. Из-за увеличения процента заболеваемости, большая часть российских регионов вынуждена переводить школьников и студентов на дистанционное обучение.

Минобрнауки и Минпросвещения обозначили свою позицию по дистанту

Новый учебный год 2021/2022 в образовательных учреждениях стартовал в очном формате. Но уже с октября 2021 года из-за повышения уровня заболеваемости коронавирусом школы и высшие учебные учреждения начали объявлять карантин по классам или даже во всему университету и переходить на дистанционный режим обучения. По окончании каникул большинство школ перешло на дистант до конца учебного года.

Руководство школы имеет право принять решение о переводе на удаленный режим обучения, если в классе или во всей школе введен карантин, а также если в образовательном учреждении выявлены случаи заболевания коронавирусом.

«Минпросвещения РФ не планирует массового закрытия школ из-за ковида, локдауна в системе образования не будет», — заявил 3 октября глава министерства Сергей Кравцов.

«Мы не предполагаем закрытия школ, только в случае крайней необходимости, если объективно существует [такая] ситуация. Но какого-то закрытия или массового локдауна не предполагаем», — сообщил министр.

Кравцов также отметил, что в РФ из-за ситуации с коронавирусом закрыты менее 0,1% школ.

«Каждый регион принимает соответствующее решение [о закрытии школ] исходя из эпидемиологической ситуации», — добавил он.

1 октября первый замминистра просвещения Александр Бугаев заявил, что на дистанционный формат обучения перешло порядка 60 школ в 28 регионах, что составляет менее 0,15% от всех школ страны. По его словам, ситуация находится под контролем ведомства.

Основания для введения карантина

Карантин — это комплекс мер, направленных на ограничение контактов заболевших лиц или граждан из группы риска. Режим карантина всегда вводится приказом руководителя школы, распоряжением департамента образования, предписанием Роспотребнадзора или иных ведомств. Вот основные нормативные акты для введения карантинов в образовательных учреждениях:

  • Федеральный закон № 52-ФЗ «О санитарно-эпидемиологическом благополучии населения в РФ»;
  • СП 3.4.2318-89 «Санитарная охрана в РФ»;
  • СП 3.1.3117-13 «Профилактика гриппа и других острых респираторных инфекций»;
  • СанПиН 2.4.2.2821-10 «Санитарно-эпидемиологические требования к общеобразовательным учреждениям».

В СП 3.4.2318-89 есть примерный перечень инфекций и заболеваний, которые могут являться основанием для введения карантинов в школе. Сюда входят ветряная оспа и опоясывающий лишай, множество паразитарных инфекций, полиовирусы и вирусные гепатиты, различные вируса гриппа, иные заболевания и инфекции.

Основанием для введения карантина обычно является превышение эпидпорога заболевших по региону или городу. Этот показатель ежегодно утверждается для наиболее распространенных инфекций и болезней в каждом субъекте РФ.

Комментарии

Ваше мнение

  • Автор несет ответственность за содержание комментария

чем опасна болезнь больших городов, как ее побороть раз и навсегда

Что это такое

Внешне приступ паники выглядит как внезапный испуг, из-за которого человек теряет контроль и неадекватно воспринимает реальность. Организм при этом испытывает мощный выброс адреналина, происходит значительное сужение сосудов, нарушается дыхание и ритм сердца: человеку кажется, что он задыхается (на самом деле нет).

Наиболее постоянные симптомы панических атак: сильный, необъяснимый страх, сильная одышка, тахикардия, головокружение, оцепенение, потливость и тошнота, боль в животе и грудине. Это усугубляет и без того паническое состояние: пострадавший думает, что у него сердечный приступ и удушье, он начинает метаться и в этом состоянии рискует выбежать на дорогу или сорваться с высоты.

 

 

Самое важное, что следует знать о панических атаках — это не смертельно. Приступ длится от нескольких секунд до пары часов. Он проходил либо сам по себе, либо — быстрее — с помощью простых техник успокоения.

 

 

Как справиться с паникой самому

В первую очередь нужно нормализовать дыхание. Из-за гипервентиляции при учащённой работе лёгких кислород в крови поднимается на 40-50%, что усугубляет состояние. Поможет обычный бумажный пакет: его нужно прижать ко рту и глубоко дышать. При отсутствии пакета можно сложить ладони чашечкой и плотно прижать их к носу и рту.

 

 

Кроме того, нужно задействовать органы чувств — это поможет отвлечься от паники. Самое простое действие — щипок или укол. Поможет и резинка на запястье: при накатывании панической волны нужно оттянуть и отпустить её. Также нужно постараться просто расслабить конечности и всё тело, переключиться на окружающую действительность: посчитать деревья, столбы, пуговицы, прохожих, вслух почитать вывески, просто поговорить с кем угодно о чём угодно.

 

 

Как помочь справиться другому человеку

Самое главное в ситуации, когда на другого человека находит паническая атака — а это всегда неожиданно — это переключить его внимание, отвлечь. Нельзя смеяться, иронизировать, издеваться над человеком, испытывающим паническую атаку. Не стоит взывать к логике и увещевать его о том, что он ошибается, ведет себя глупо, что всё в порядке. В данную минуту — не всё в порядке. Ваша задача помочь, а не доказать свое мнение. Нужно взять его за руки, похлопывать по плечу, стараться поддерживать зрительный контакт. Ни в коем случае не трясите и не кричите на человека, это усугубит ситуацию. Ваша речь должна быть спокойной и ровной, тон — мягким и уверенным. Когда контакт установится, нужно мягко и заботливо убедить человека, что ничего его жизни не угрожает, что паника скоро пройдёт, а до того момента вы не оставите его.

 

 

Старайтесь нормализовать дыхание пострадавшего — это самый лучший метод для успокоения. Есть пакет — пусть дышит в него, нет пакета — дышите вместе, глубоко и ровно.

 

 

Из-за чего случаются панические атаки

Основные причины — стрессовый образ жизни, отсутствие режима, постоянное напряжение. Есть и отдельные мощные провокаторы: алкоголь, никотин, наркотики разной тяжести, энергетики и кофе — спутники около 70% приступов паники.

Разбитые биоритмы вкупе со стрессом и загруженностью на работе вызовут внутренний сбой, из-за которого организм в прямом смысле бьёт тревогу.

 

 

Профилактика панических атак

Правила предельно просты. Необходим полноценный отдых, спать нужно не менее восьми часов в сутки. Алкоголь, никотин, психотропные вещества должны быть исключены или сведены до минимума, как и кофе и крепкий чай. Следует наладить режим питания и сделать еду сбалансированной.

 

 

Вообще, режим и распорядок — вот два мощнейших стража человеческой психики. Расписание поможет привести в порядок биоритмы и научит тело подстраиваться под них.

 

 

Чем страшны панические атаки

Кроме того, что они основательно портят жизнь — ничем. Панические атаки не грозят организму последствиями, но сосуществовать с ними крайне тяжело. Дело в том, что организм не понимает, что паника не смертельна, поэтому вбрасывает симптомы, характерные для серьёзных заболеваний: боли в ЖКТ, тяжесть в грудной клетке, страх сойти с ума. На деле же панические атаки ни к чему подобном у не приводят.

Более глубокая опасность в вероятности спровоцировать уже имеющиеся хронические заболевания. Кроме того, панические атаки в дружбе с тревожностью вызовут фобии — а это уже совсем другой уровень. Плюс, как говорится не угрожаете болезни от нервов. А нервы панические атаки расшатывают очень быстро.

 

 

Что делать, чтобы избавиться от паники

Людям с паническими атаками очень важна постоянная поддержка близких. Одиночество — это большая беда в их недуге. Кроме того, при любых проявлениях этого расстройства нужно обратиться к врачу. Он назначит необходимую и своевременную терапию и предотвратит новые приступы.

 

 

Психотерапевт объяснит, что происходит, подберёт индивидуальное лечение. Просить помощи специалиста — это не постыдно, а верный шаг к нормальной жизни без тревоги и паники, ведь такая жизнь — бесценна.

 

Фото: из открытых источников

вакцинаций против гриппа во время беременности | ACOG

Номер 732 (Заменяет Заключение Комитета № 608, сентябрь 2014 г. Подтверждено в октябре 2021 г.)

Комитет по акушерской практике

Это заключение Комитета было разработано Американской коллегией акушеров и гинекологов. и Комитет по акушерской практике в сотрудничестве с доктором медицины Нилом С. Сильверманом и доктором Ричардом Бейги.


РЕФЕРАТ: Вакцинация против гриппа является важным элементом предбеременной, дородовой и послеродовой помощи, поскольку грипп может привести к серьезным заболеваниям, включая более высокую вероятность развития пневмонии, если это происходит в дородовой или послеродовой период. Помимо госпитализации, беременные, заболевшие гриппом, подвергаются повышенному риску госпитализации в отделение интенсивной терапии и неблагоприятных перинатальных и неонатальных исходов.Консультативный комитет по практике иммунизации Центров по контролю и профилактике заболеваний и Американский колледж акушеров и гинекологов рекомендуют, чтобы все взрослые получали вакцину против гриппа ежегодно, а беременным или беременным женщинам в сезон гриппа сразу же вводили инактивированную вакцину против гриппа. доступен. В Соединенных Штатах сезон гриппа обычно длится с октября по май. В идеале вакцинацию против гриппа следует проводить до конца октября, но рекомендуется проводить вакцинацию в течение всего сезона гриппа, чтобы обеспечить защиту в период циркуляции.Любую лицензированную, рекомендованную, соответствующую возрасту инактивированную вакцину против гриппа можно безопасно вводить в течение любого триместра. Поэтому критически важно, чтобы акушеры-гинекологи и другие акушерские работники рекомендовали и пропагандировали вакцину против гриппа. Акушерам-гинекологам рекомендуется хранить и вводить вакцину против гриппа своим беременным пациенткам в своих кабинетах, и они должны сами делать вакцину против гриппа каждый сезон. Если вакцина против гриппа не может быть предложена на практике, акушеры-гинекологи и поставщики акушерских услуг должны направить пациентов к другому поставщику медицинских услуг, в аптеку или общественный центр вакцинации.Это обновленное Заключение Комитета включает более свежие данные о безопасности и эффективности вакцинации против гриппа во время беременности, а также рекомендации по лечению и постконтактной химиопрофилактике.


Рекомендации

Американский колледж акушеров и гинекологов (ACOG) дает следующие рекомендации:

  • Консультативный комитет Центров по контролю и профилактике заболеваний (CDC) по практике иммунизации и ACOG рекомендуют всем взрослым ежегодно проходить вакцинацию против гриппа. и что женщины, которые беременны или будут беременны во время сезона гриппа (гриппа), должны получить инактивированную вакцину против гриппа, как только она станет доступной.Любую лицензированную, рекомендованную, соответствующую возрасту инактивированную вакцину против гриппа можно безопасно вводить в течение любого триместра.

  • Иммунизация матерей против гриппа является важным компонентом дородового ухода за женщинами и их новорожденными. Акушеры-гинекологи и другие поставщики медицинских услуг должны консультировать беременных женщин о безопасности и пользе иммунизации против гриппа для них самих и их плодов, а также пропагандировать преимущества пассивного иммунитета от материнской иммунизации для их новорожденных.

  • Акушерам-гинекологам рекомендуется хранить и вводить вакцину против гриппа своим беременным пациенткам в своих кабинетах, и они должны сами получать вакцину от гриппа каждый сезон.

  • Если вакцина против гриппа не может быть предложена на практике, акушеры-гинекологи и поставщики акушерских услуг должны направить пациентов к другому поставщику медицинских услуг, аптеке или общественному центру вакцинации.

  • Акушеры-гинекологи должны настоятельно рекомендовать своим сотрудникам делать прививки от гриппа каждый сезон.

  • Лица с аллергией на яйца в анамнезе, у которых была крапивница только после контакта с яйцом, могут получить любую лицензированную и рекомендованную вакцину против гриппа, которая в остальном соответствует их возрасту и состоянию здоровья.

  • В случае более серьезных аллергических симптомов, чем крапивница, вакцину следует вводить в стационарных или амбулаторных условиях (включая, помимо прочего, больницы, клиники, отделения здравоохранения и кабинеты врачей).

  • Пациенты с гриппоподобным заболеванием должны лечиться противовирусными препаратами предположительно независимо от статуса вакцинации. Медицинские работники не должны полагаться на результаты тестов для начала лечения и должны лечить пациентов предположительно на основе клинической оценки.

  • Из-за высокой вероятности заболеваемости CDC и ACOG рекомендуют проводить постконтактную противовирусную химиопрофилактику (75 мг осельтамивира один раз в день в течение 10 дней) беременным женщинам и женщинам в послеродовом периоде до 2 недель (включая потерю беременности. ), которые имели тесный контакт с человеком, который мог заразиться гриппом.Если осельтамивир недоступен, можно заменить занамивер, две ингаляции один раз в день в течение 10 дней.


Введение

Опубликованные данные продолжают демонстрировать необходимость вакцинации против гриппа во время беременности, а также важность рекомендации и проведения вакцинации в офисе 1 2 3 4. В течение сезона гриппа 2016–2017 гг. 53,6% женщин сообщили, что получали вакцину против гриппа до или во время беременности 5. Хотя эти цифры отражают значительный прогресс, еще многое предстоит сделать, чтобы соответствовать U.S. Health and Human Services «Здоровые люди 2020» цель вакцинации 80% беременных женщин от гриппа 6. Рабочая группа экспертов по иммунизации и новым инфекциям Американского колледжа акушеров и гинекологов и Комитет по акушерской практике рекомендуют всем беременным женщинам во время сезона гриппа получить инактивированную вакцину против гриппа в соответствии с рекомендациями Консультативного комитета CDC по практике иммунизации 5. Это обновленное заключение комитета включает более свежие данные о безопасности и эффективности вакцинации против гриппа во время беременности и рекомендации по лечению и постконтактной химиопрофилактике.


Общие сведения

Вакцинация против гриппа является важным элементом предбеременной, дородовой и послеродовой помощи, поскольку грипп может привести к серьезным заболеваниям, включая более высокую вероятность развития пневмонии, если это происходит в дородовой или послеродовой период. Например, ретроспективное когортное исследование в Новой Шотландии показало, что женщины, госпитализированные по поводу респираторного заболевания во время беременности (особенно в третьем триместре), чаще имели большее количество посещений врача или большую продолжительность пребывания по сравнению с количеством посещений. за год до беременности 7.В этом исследовании связь между статусом беременности и госпитализацией была особенно очевидной для женщин с сопутствующими заболеваниями 7. Однако важно отметить, что многие исследования, включая вышеупомянутое, не смогли подтвердить диагноз гриппа лабораторными результатами, и необходимы дополнительные исследования с использованием подтверждающих лабораторных результатов у беременных женщин. Помимо госпитализации, беременные, заболевшие гриппом, подвергаются повышенному риску госпитализации в отделение интенсивной терапии и неблагоприятных перинатальных и неонатальных исходов 8 9 10.Наконец, заболеваемость и смертность среди беременных женщин возрастают во время пандемий гриппа, включая пандемию гриппа h2N1 2009 года 10 11 12 13 14 15 16 17 18. В совокупности эти данные подчеркивают важность вакцинации против гриппа как жизненно важного вмешательства, которое все акушеры-гинекологи и другие поставщики акушерской помощи должны рекомендовать и назначать.

В Соединенных Штатах сезон гриппа обычно длится с октября по май. Консультативный комитет CDC по практике иммунизации и ACOG рекомендуют, чтобы все взрослые получали ежегодную вакцину против гриппа, а женщины, которые беременны или будут беременны во время сезона гриппа, получали инактивированную вакцину против гриппа, как только она будет доступна.В идеале вакцинацию против гриппа следует проводить до конца октября, но рекомендуется проводить вакцинацию в течение всего сезона гриппа, чтобы обеспечить защиту в период циркуляции. Инактивированную вакцину против гриппа можно вводить всем беременным женщинам в течение любого пятого триместра. Поскольку вакцины против гриппа рекомендуются ежегодно для всех взрослых, беременных женщин следует вакцинировать, даже если они получили вакцину от гриппа во время предыдущей беременности. Вакцинация в послеродовом периоде является альтернативой только тогда, когда вакцинация во время беременности не может быть завершена.


Безопасность

Многочисленные исследования, включая клинические испытания и обсервационные исследования, а также данные систем отчетности по безопасности неизменно продемонстрировали безопасность вакцинации против гриппа во время беременности 19 20 21 22 23. На сегодняшний день проведено только одно небольшое ретроспективное исследование случай-контроль. предположили возможную связь между получением вакцины против гриппа, содержащей A / h2N1pdm, в начале первого триместра и самопроизвольным абортом у женщин, которые также получили вакцину против гриппа, содержащую A / h2N1pdm, в предыдущем сезоне гриппа 24.Эта связь не наблюдалась в другие сезоны или другие версии вакцины против гриппа. Из-за отсутствия доказательств биологической достоверности, нескольких заметных недостатков в этом исследовании и преобладания других данных, не показывающих связи, рекомендация по вакцинации против гриппа, вводимой в любом триместре, не изменилась 24 25. Хотя некоторые исследователи выразили опасения, что тимеросал , содержащий ртуть консервант, используемый во флаконах с несколькими дозами вакцины против гриппа, может быть небезопасным, нет научных доказательств того, что вакцины, содержащие тимеросал, вызывают проблемы со здоровьем или развитием у детей, рожденных женщинами, получившими вакцину с тимеросалом во время беременности 26 27 28.Таким образом, несмотря на то, что препараты противогриппозной вакцины без тимеросала доступны, Консультативный комитет CDC по практике иммунизации не указывает на предпочтение вакцин, содержащих тимеросал или не содержащих тимеросал, для какой-либо группы, включая беременных женщин 19.

Лица с историей страдающих аллергией на яйца, у которых возникла только крапивница после контакта с яйцом, можно получить любую лицензированную и рекомендованную вакцину против гриппа, которая в остальном соответствует их возрасту и состоянию здоровья.Недавнее исследование показало, что частота анафилаксии после всех прививок составляет 1,31 на миллион введенных доз вакцины 29. Лица, которые сообщают о реакциях на яйцо с симптомами, отличными от крапивницы (такими как ангионевротический отек, респираторный дистресс, головокружение или рецидивирующая рвота) или Те, кому потребовался адреналин или другое неотложное медицинское вмешательство, также могут получить любую лицензированную и рекомендованную вакцину против гриппа. Однако в случае более серьезных аллергических симптомов, чем крапивница, вакцину следует вводить в стационарных или амбулаторных условиях (включая, помимо прочего, больницы, клиники, отделения здравоохранения и кабинеты врачей).

Введение вакцины должно осуществляться под контролем поставщика медицинских услуг, который может распознать тяжелые аллергические состояния и справиться с ними. Предыдущая тяжелая аллергическая реакция на противогриппозную вакцину, а не на яйца, независимо от того, какой компонент предположительно ответственен за реакцию, является единственным текущим противопоказанием к будущему получению вакцины против гриппа 5.

В настоящее время беременные женщины должны получать любую лицензированную вакцину. рекомендуемая соответствующая возрасту инактивированная вакцина против гриппа в течение любого триместра 5.Если время введения противостолбнячного анатоксина, восстановленного анатоксина дифтерии, бесклеточной коклюшной вакцины (Tdap) и вакцины против гриппа совпадает, введение обеих вакцин во время одного визита безопасно и эффективно. Для кормящих женщин также безопасно получить вакцину от гриппа, если они не получили ее во время беременности.


Эффективность и преимущества

Эффективность вакцинации против сезонного гриппа у беременных женщин аналогична ее эффективности среди взрослого населения в целом 30.Хотя эффективность вакцины против гриппа может быть ниже, чем у других вакцин для взрослых, вакцинация по-прежнему обеспечивает значительную защиту от гриппа. Он может уменьшить тяжесть последствий гриппа, когда инфекция действительно происходит, и является основным профилактическим вмешательством для беременных. Исследование, проведенное в сезон гриппа 2012–2013 гг., Показало, что вакцинированные беременные женщины имели значительно меньшее количество госпитализаций, чем те, кому не исполнилось 31 года.

Вакцинация против гриппа во время беременности также может принести пользу новорожденным женщин, получивших вакцину.Четыре крупномасштабных рандомизированных контролируемых испытания и многочисленные обсервационные исследования продемонстрировали защиту новорожденных от вакцинации против гриппа матерей 32 33 33 34 35. Исследования также продемонстрировали сокращение госпитализаций в связи с инфекцией гриппа среди младенцев, рожденных женщинами, получившими вакцину во время беременности 36 37. Таким образом, поскольку вакцина против гриппа неэффективна для детей младше 6 месяцев, пассивная иммунизация плодов антителами, передающимися через плаценту, в настоящее время является лучшей стратегией профилактики для новорожденных 32.Таким образом, иммунизация материнского гриппа является важным компонентом дородового ухода за женщинами и их новорожденными. Акушеры-гинекологи и другие медицинские работники должны консультировать беременных женщин о пользе иммунизации против гриппа для них самих и их плодов, а также пропагандировать преимущества пассивного иммунитета от материнской иммунизации для их новорожденных.


Лечение и постконтактная химиопрофилактика беременных женщин

Беременные женщины подвержены высокому риску серьезных осложнений гриппа, таких как госпитализация в отделение интенсивной терапии, преждевременные роды и материнская смерть.Пациентов с гриппоподобным заболеванием следует лечить противовирусными препаратами предположительно независимо от прививочного статуса. Предпочтительно лечение осельтамивиром (75 мг два раза в день в течение 5 дней); однако, если осельтамивир недоступен, можно заменить занамивир (две ингаляции [10 мг] два раза в день в течение 5 дней). Медицинские работники не должны полагаться на результаты анализов для начала лечения и должны лечить пациентов предположительно на основании клинической оценки 38.

Из-за высокого риска заболеваемости CDC и ACOG рекомендуют постконтактную противовирусную химиопрофилактику (75 мг осельтамивира один раз в день для 10 дней) следует рассматривать для беременных женщин и женщин с послеродовым периодом до 2 недель (включая потерю беременности), которые имели тесный контакт с кем-то, кто мог быть инфицирован гриппом.Если осельтамивир недоступен, можно заменить занамивир, две ингаляции один раз в день в течение 10 дней. Всем беременным женщинам или женщинам, находящимся в первые 2 недели после родов, следует посоветовать немедленно обратиться за обследованием при появлении ранних признаков и симптомов инфекции гриппа (например, повышение температуры выше 100 ° F в сочетании с одышкой, обмороком или грудной клеткой). боли) 38. Для получения дополнительной информации о лечении и дозировке см. алгоритм оценки сезонного гриппа и лечения беременных женщин с гриппоподобными заболеваниями ACOG и Общества по оценке сезонного гриппа и лечения беременных женщин с гриппоподобными заболеваниями Общества медицины плода и матери на сайте www.acog.org/More-Info/FluVaccine.


Роль акушера-гинеколога

Обсуждение с пациентами последствий гриппа и потенциальных преимуществ вакцинации во время беременности особенно важно, поскольку отсутствие знаний о преимуществах вакцины против гриппа оказалось препятствием для вакцинации принятие 39 40 41. Учебные пособия с простыми подсказками в виде таблиц увеличивают частоту обсуждений между врачами и беременными женщинами относительно вакцинации против гриппа 42.Более того, исследования неизменно предполагают, что, когда рекомендации по вакцинации против гриппа во время беременности исходят непосредственно от акушера-гинеколога или другого акушерского врача и вакцина доступна в кабинете врача, вероятность принятия и получения вакцины составляет от 5 до 50. раза выше 1 2. Поэтому критически важно, чтобы все акушеры-гинекологи и другие акушеры рекомендовали и пропагандировали вакцину против гриппа. Акушерам-гинекологам рекомендуется хранить и вводить вакцину против гриппа своим беременным пациенткам в своих кабинетах, и они должны сами делать вакцину против гриппа каждый сезон.В зависимости от размера клиники и предоставляемых услуг в офисе может не быть средств для хранения и предложения вакцины от гриппа. Если вакцина против гриппа не может быть предложена на практике, акушеры-гинекологи и поставщики акушерских услуг должны направить пациентов к другому поставщику медицинских услуг, в аптеку или общественный центр вакцинации.

Если пациент получает вакцину от гриппа вне кабинета акушера-гинеколога, важно, чтобы учреждение, проводившее вакцинацию, предоставило надлежащую документацию по вакцине, если это учреждение не работает напрямую с централизованной программой регистрации вакцины, так что запись прививок может быть обновлена ​​соответствующим образом.Эти совместные усилия являются мощным сигналом для беременных женщин о том, что вакцинация очень важна для их защиты и для их новорожденных.


Заключение

Беременные женщины особенно уязвимы для инфекции гриппа и связанных с ней заболеваний; Таким образом, вакцинация против гриппа является неотъемлемым элементом дородовой, дородовой и послеродовой помощи. Крайне важно, чтобы акушеры-гинекологи, другие поставщики медицинских услуг, медицинские организации и должностные лица общественного здравоохранения продолжали усилия по повышению уровня вакцинации против гриппа среди беременных женщин.Это принесет пользу женщинам и их новорожденным.


Дополнительная информация

Американский колледж акушеров и гинекологов выявил дополнительные ресурсы по темам, связанным с этим документом, которые могут быть полезны акушерам-гинекологам, другим поставщикам медицинских услуг и пациентам. Вы можете просмотреть эти ресурсы по адресу: www.acog.org/More-Info/FluVaccine.

Эти ресурсы предназначены только для информации и не могут быть исчерпывающими. Обращение к этим ресурсам не означает одобрения Американским колледжем акушеров и гинекологов организации, веб-сайта организации или содержания ресурса.Ресурсы могут быть изменены без предварительного уведомления.

Авторские права, апрель 2018 г., Американская коллегия акушеров и гинекологов. Все права защищены. Никакая часть данной публикации не может быть воспроизведена, сохранена в поисковой системе, размещена в Интернете или передана в любой форме и любыми средствами, электронными, механическими, путем фотокопирования, записи или иными способами, без предварительного письменного разрешения издателя.

Запросы на разрешение на изготовление фотокопий следует направлять в Центр защиты авторских прав, 222 Rosewood Drive, Danvers, MA 01923, (978) 750-8400.

Американский колледж акушеров и гинекологов 409 12th Street, SW, PO Box 96920, Вашингтон, округ Колумбия 20090-6920

Вакцинация против гриппа во время беременности. Заключение комитета ACOG № 732. Американский колледж акушеров и гинекологов. Obstet Gynecol 2018; 131: e109–14.

Эта информация разработана как образовательный ресурс, чтобы помочь клиницистам в оказании акушерской и гинекологической помощи, и использование этой информации является добровольным. Эта информация не должна рассматриваться как включающая все надлежащие методы лечения или методы ухода или как изложение стандарта ухода.Он не предназначен для замены независимого профессионального суждения лечащего врача. Вариации на практике могут быть оправданы, когда, по разумному мнению лечащего врача, такой курс действий определяется состоянием пациента, ограниченностью доступных ресурсов или достижениями в знаниях или технологиях. Американский колледж акушеров и гинекологов регулярно проверяет свои публикации; однако его публикации могут не отражать самые последние свидетельства.Любые обновления этого документа можно найти на сайте www.acog.org или позвонив в ресурсный центр ACOG.

Несмотря на то, что ACOG прилагает все усилия для представления точной и надежной информации, данная публикация предоставляется «как есть», без каких-либо явных или подразумеваемых гарантий точности, надежности или иным образом. ACOG не гарантирует и не подтверждает продукты или услуги какой-либо фирмы, организации или лица. Ни ACOG, ни его должностные лица, директора, члены, сотрудники или агенты не несут ответственности за любые убытки, ущерб или претензии в отношении любых обязательств, включая прямые, особые, косвенные или косвенные убытки, понесенные в связи с этой публикацией или доверием. по представленной информации.

Путешественники и грипп: риски и профилактика | Журнал медицины путешествий

Общие сведения : Вирусы гриппа являются одной из основных причин серьезных инфекций дыхательных путей человека во всем мире. В связи с высоким бременем болезней, связанных с гриппом, эти вирусы играют важную, но часто игнорируемую роль в медицине путешествий. Руководств и рекомендаций по профилактике и лечению гриппа у путешественников немного.Особый интерес для медицины путешествий представляют группы риска, а также обстоятельства, способствующие передаче и распространению вируса гриппа, такие как путешествия на самолете или круизном лайнере и массовые собрания.

Методы : Мы провели поиск в PUBMED / MEDLINE комбинации терминов MeSH: вирус гриппа, путешествия, массовые собрания, крупномасштабные мероприятия и круизное судно. Кроме того, мы собрали руководящие принципы и рекомендации из отдельных стран по профилактике и лечению гриппа у путешественников.Анализируя эти результаты поиска в свете опубликованных знаний в области профилактики и лечения гриппа, мы представляем рекомендации по передовой практике профилактики и лечения гриппа в туристической медицине.

Результаты : Сезонный грипп — одно из самых распространенных инфекционных заболеваний среди путешественников. К известным факторам риска, связанным с хозяином, относятся пожилой возраст и ослабленный иммунитет, в то время как наиболее важные факторы окружающей среды связаны с праздничными круизами и массовыми собраниями.

Выводы: Предварительная консультация должна касаться гриппа и его профилактики для путешественников, когда это возможно, исходя из соответствующей эпидемиологической ситуации. Путешественникам с высоким риском развития осложнений следует настоятельно рекомендовать превентивные меры. Кроме того, вакцинация против сезонного гриппа должна быть рассмотрена для всех путешественников, желающих снизить риск потери трудоспособности, особенно для членов экипажа и пассажиров круизных судов, а также для тех, кто участвует в массовых собраниях.Помимо рекомендаций относительно профилактических мер и вакцинации, некоторые путешественники могут рассмотреть возможность использования противовирусных препаратов.

Введение

Вирусы гриппа, члены семейства Orthomyxoviridae , относятся к числу наиболее разнообразных возникающих инфекционных агентов и вызывают преимущественно респираторные заболевания у людей. Из трех типов вируса гриппа (A, B и C) грипп A наиболее известен своей способностью дрейфовать, повторно сортировать и вызывать ежегодные сезонные вспышки в регионах с умеренным климатом.Существует три формы человеческого гриппа: сезонный, птичий и пандемический. Сезонный грипп вызывается вирусами гриппа A или B и ежегодно поражает 5–15% населения. 1 Симптомы варьируются от легких респираторных жалоб до фатального респираторного дистресс-синдрома, также могут возникать субклинические инфекции. Тяжесть инфекции и исход болезни во многом зависят от вируса гриппа, иммунитета и состояния здоровья инфицированного человека. Большинство случаев инфицирования вирусом сезонного гриппа проходят самостоятельно, и пациентам не требуется обращаться за медицинской помощью.Однако в большинстве случаев сезонный грипп действительно вызывает значительное бремя болезней, особенно у лиц с высоким риском осложнений. 2 Спорадические заражения людей вирусами птичьего гриппа А могут вызывать серьезные и даже смертельные заболевания, но эти вирусы не передаются эффективно среди людей. Однако птичий вирус, который в результате мутации и / или повторной сортировки приобретает способность эффективно передаваться от человека к человеку, может стать основой новой пандемии.В прошлом веке произошло четыре основных пандемии гриппа: в 1918–1920 гг. (Испанский грипп), 1957–1958 гг. (Азиатский грипп), 1968–1970 гг. (Гонконгский грипп) и недавно в 2009–2010 гг. (Мексиканский или «свиной» грипп). . Некоторые штаммы птиц, патогенные для человека, могут напрямую передаваться от птиц человеку, а также могут адаптироваться к передаче от человека к человеку путем мутации или повторной сортировки, 3 , 4 вирусы птичьего гриппа следует рассматривать угроза здоровью. 5

Несколько обзоров, недавно посвященных эпидемиологии вируса гриппа, группам высокого риска, стратегиям вакцинации и лечению. 6–10 Однако одна быстрорастущая группа риска — путешественники — в большинстве случаев отсутствует в этих обзорах. Несколько изменений в нашем глобализирующемся мире способствуют растущему значению этой группы: (i) постоянное увеличение общего объема путешествий во всем мире, (ii) появление массового туризма и (iii) увеличение числа пожилых путешественников с ослабленным иммунитетом. Эти изменения подчеркивают важность согласованных международных и национальных руководств по профилактике и лечению гриппа в туристической медицине.Например, легко представить, как крупные общенациональные религиозные собрания, такие как хадж и умра, или международные спортивные мероприятия и фестивали, могут способствовать глобальному распространению гриппа. Современные транспортные средства, которые собирают большое количество людей в относительно небольших помещениях, такие как круизные лайнеры и самолеты или аэропорты, также могут потребовать особого внимания с точки зрения общественного здравоохранения. Здесь мы обобщаем существующие руководящие принципы и обсуждаем рекомендации, касающиеся профилактики и лечения гриппа с точки зрения путешественника, включая использование вакцин и противовирусных препаратов, а также гигиенические и социальные меры.Особое внимание уделяется последствиям авиаперелетов и путешествий на круизных лайнерах, путешествиям в тропические регионы и между полушариями, массовым собраниям, необходимым действиям и направлениям будущих исследований.

Методы

Поиск в PUBMED / MEDLINE был выполнен с использованием комбинации терминов MeSH «Вирус гриппа», «путешествия», «массовые сборы», круизные лайнеры и крупномасштабные события до июня 2016 г. Были включены только статьи, написанные на английском языке. Кроме того, мы собрали руководящие принципы и рекомендации из отдельных стран и организаций общественного здравоохранения, связанных с Международным обществом туристической медицины, с доступными онлайн-руководствами по туристической медицине.Наконец, мы сравнили и оценили эти результаты поиска в свете опубликованных в настоящее время знаний в области профилактики и лечения гриппа. По результатам поиска PUBMED / MEDLINE было найдено 828 статей, из которых после проверки авторами на релевантность были включены 73.

Результаты

Эпидемиология сезонного гриппа у путешественников

Сезонный грипп является наиболее частым заболеванием, которое можно предотвратить с помощью вакцинации, 11 с риском заражения, начинающимся в начале путешествия, i.е. сбор для транспортировки (например, автобусы, поезда и аэропорты), когда имеют место все более прямые и косвенные контакты между людьми. Вирус гриппа может передаваться воздушно-капельным путем, а также при контакте с загрязненными поверхностями, например при прикосновении к дверным ручкам и последующем прикосновении к слизистым оболочкам. 3 Скорее всего, вирусы сезонного гриппа сначала реплицируются в столбчатых эпителиальных клетках верхних дыхательных путей. Оттуда вирус может распространяться по дыхательным путям.Выделение сезонных штаммов из верхних дыхательных путей может быть очень эффективным, и вирус может быть легко извлечен из дыхательных выделений до появления симптомов и в течение 5-8 дней после того, как симптомы станут очевидными.

Факторы окружающей среды и риск заражения вирусом гриппа во время путешествия

Среди сложных эпидемиологических аспектов сезонного гриппа у путешественников — различия в сезонности и штаммах вирусов между климатическими зонами, а также между северным и южным полушариями.В тропических регионах вирусы гриппа могут циркулировать круглый год с несколькими сезонными пиками, тогда как в зонах с умеренным климатом циркуляция в основном ограничивается одним или двумя пиками в осенние и зимние месяцы. 12 Последние данные выявили интересные закономерности возникновения и распространения вариантов антигенного дрейфа, показывающие глобальную циркуляцию различных вирусов сезонного гриппа. Эти наблюдения имеют большое значение для выбора вирусов, которые должны быть представлены в сезонных вакцинах, что время от времени приводит к тому, что различные штаммы представлены в вакцинах против сезонного гриппа для северного и южного полушарий. 13 , 14

В нескольких исследованиях предпринимались попытки оценить эффективность передачи гриппа во время путешествия; особенно авиаперевозки. Например, в исследовании четырех рейсов в Северной Америке, перевозящих больных пассажиров с подтвержденной пандемической инфекцией h2N1 (2009 г.), рассчитывалась общая частота атак для острой респираторной инфекции и гриппоподобного заболевания (ГПЗ). В течение 1–7 дней после поездки уровень нападения пассажиров составил 5,2 и 2,4% соответственно, из которых значительная часть была подтверждена серологическими исследованиями на грипп. 15 Эти результаты согласуются с ретроспективным исследованием передачи пандемической инфекции h2N1 в полете (2009 г.), в котором у 3% инфицированных пассажиров развились ГПЗ в дни после полета. Размещение в той же области (до двух строк друг от друга), что и индексный случай с ГПЗ, привело к значительному увеличению риска. 16 Другие исследования с использованием отслеживания контактов, математического моделирования 17 и экспериментальной настройки воздушной кабины подтвердили условия, предрасполагающие к передаче гриппа по каплям во время полетов. 18–21

Повышенный риск заражения сезонным гриппом, по-видимому, не ограничивается периодом непосредственно до и во время фактического полета, а сохраняется после выхода из самолета. Несколько исследований показали высокий уровень заболеваемости подтвержденной инфекцией сезонными вирусами гриппа во время путешествий, причем самый последний анализ документально подтвердил показатель 8,9 (95% ДИ 7,1–10,9) на 100 человеко-месяцев. 11 , 12 Однако только ∼10% имели ГПЗ.Среди голландцев, путешествующих на длительный срок, частота серологически подтвержденной инфекции во время путешествия составила 15%, а симптоматической инфекции — 6,3% (только лихорадка) и 2% (ГПЗ), соответственно. 23 Результаты исследования сети GeoSentinel Surveillance Network показали, что люди, путешествующие в Восточную и Юго-Восточную Азию, имеют в 7 раз более высокий риск заражения гриппом по сравнению с теми, кто путешествует в другие места. 24 Заражение вирусом гриппа у путешественников в основном происходит вне сезона эпидемии в стране отправления, и особенно подвержены риску те, кто навещает своих родственников и родственников или находится за границей более 30 дней. 22 , 23 , 25 GeoSentinel и EuroTravNet действуют как сети наблюдения, которые отслеживают все связанные с поездками заболевания, о которых сообщается в любую из их клиник по всему миру. Данные, собранные этими организациями, показывают, что в 2008 году, до пандемии h2N1, число подтвержденных случаев гриппа составляло всего 0,1%. Однако в 2009 г. число подтвержденных случаев гриппа выросло до значений распространенности 11, 12, 18 и достигло 32%, причем большинство из них приходится на ph2N1. 24 , 26–28 Тесный контакт между людьми может также происходить во время массовых собраний или на борту круизных судов, как описано ниже.

Факторы хоста

Высокая заболеваемость и смертность от гриппа особенно характерны для лиц крайнего возраста (пожилые и очень молодые), лиц с сопутствующими заболеваниями и беременных женщин. 29 Основными состояниями здоровья, особенно связанными с повышенным риском осложненного гриппа, являются люди с ослабленным иммунитетом либо из-за основного заболевания, либо из-за иммуномодулирующего лечения, например, у реципиентов трансплантата органов и лиц, принимающих лекарства от аутоиммунных состояний. 30 Кроме того, хроническое заболевание легких 31 , сахарный диабет, сердечно-сосудистые заболевания и злокачественные новообразования также считаются факторами риска развития тяжелого гриппа или осложнений. 32

Воздействие на путешественников

Даже относительно легкая, самоограничивающаяся инфекция вирусом сезонного гриппа может иметь решающее влияние на успех отпуска или деловой поездки. Кроме того, грипп может испортить поездки спортсменов на международные соревнования и артистов на выступления за границу или на общественные мероприятия, такие как свадьбы.Среди широко известных примеров, распространенных в СМИ, — сборная Германии по футболу и ее тренер во время чемпионата мира 2010 года в Южной Африке, а также концерт известной рок-звезды, который пришлось отменить из-за гриппа. 33–35

Крупное исследование вирусной инфекции гриппа у лиц, путешествующих в тропические и субтропические страны, показало, что 1,1% путешественников, участвовавших в исследовании, имели сероконверсию и что 40% из тех, у кого была сероконверсия, обращались за медицинской помощью во время своего путешествия. путешествия: очень значительное число. 25 Инфекции, вызванные вирусом гриппа, были получены в основном из Азии (47,5%), Африки (27,5%) и Латинской Америки (25%). 25

Важно отметить, что, независимо от поездок, вспышки сезонного гриппа неоднократно ассоциировались с плохими результатами даже у пациентов без сопутствующих заболеваний: в том числе у небольшого числа пациентов, у которых развивается тяжелый и даже смертельный грипп, а также опасный для жизни осложнения. Примеры включают пациентов с тяжелой вирусной пневмонией, острым респираторным дистресс-синдромом (ОРДС), постгриппозной инфекцией Staphylococcus aureus с потенциально устойчивой к метициллину S.aureus или редкие примеры миокардита и энцефалита. 32 , 36 , 37 В настоящее время общепринято, что даже здоровые люди имеют низкий, но важный риск развития тяжелого заболевания, связанного с гриппом. 2 Кроме того, сезонный грипп несет значительное экономическое бремя из-за отпуска по болезни, медицинского обслуживания и лекарств. Неожиданные медицинские события во время путешествия могут быть особенно дорогостоящими.

Меры профилактики и лечения

Есть несколько способов снизить риск заражения гриппом. Прежде всего, гигиенические меры, включая активную вентиляцию мест массового скопления людей, гигиену рук и (возможно) ношение маски для лица, могут снизить риск распространения гриппа. Профилактика гриппа с помощью вакцинации и конкретные проблемы, связанные с вакцинацией путешественников от гриппа, более подробно рассматриваются ниже. В качестве дополнения к вакцинации также обсуждается значение ранней противовирусной терапии или профилактического использования противовирусных препаратов.

Меры гигиены

Несколько исследований изучали эффективность нефармацевтических вмешательств (НПИ) в сокращении распространения вируса гриппа, особенно в случае пандемии. Что касается сезонного гриппа, наибольшее внимание уделяется гигиене рук и использованию масок для лица. Эти NPI могут быть особенно важны, когда кто-то из ближайшего окружения или попутчик инфицирован. 38 Например, тщательная гигиена рук и использование лицевых масок, по-видимому, сокращают передачу вируса гриппа в домашних условиях, если они применяются в течение 36 часов с момента появления симптомов у индексного пациента. 39 Общая польза гигиены рук и масок для снижения распространения гриппа была подтверждена недавним метаанализом 40 , хотя качество данных во многих исследованиях, особенно в отношении детей, относительно низкое. 41 Кроме того, в исследованиях, посвященных сценариям, в которых существует активная, продолжающаяся передача гриппа среди населения, например, во время пандемии, наблюдались большие различия в эффективности этих NPI. Несмотря на эти ограничения, кажется, есть достаточно доказательств, чтобы сделать вывод о том, что маски для лица, гигиена рук и уменьшение скопления людей эффективны в снижении распространения гриппа. 42 Гигиена рук была бы относительно простой для путешественников, и несколько исследований показывают, что использование дезинфицирующих средств на спиртовой основе и мытье рук после прикосновения к загрязненным поверхностям могут быть эффективными. 43 , 44

Однако эти испытания не проводились на путешественниках. Использование лицевых масок у путешественников вызывает особые споры и может иметь ощутимое влияние только в том случае, если заражен их близкий собеседник (т. Е. Общие жилые помещения). 45 При массовых собраниях, похоже, наблюдается (очень) умеренное снижение риска заражения людей, использующих маски. 46 Кроме того, общая эффективность масок и респираторов, вероятно, зависит от постоянного и правильного использования. 47 В этом свете важно отметить, что до 40% случаев гриппа могут передаваться до появления симптомов. 48

Антивирусные программы для путешественников

Другой потенциальной профилактической стратегией гриппа является использование противовирусных препаратов в профилактических целях или для раннего лечения.В настоящее время наиболее эффективными противогриппозными препаратами являются ингибиторы нейраминидазы (НИ: осельтамивир, занамивир и перамивир). 49 Ингибиторы M2 (амантадин и римантадин) используются редко, поскольку они страдают от быстрого развития устойчивости к вирусам, и практически все циркулирующие в настоящее время вирусы сезонного гриппа А имеют уже существующую устойчивость. 50 Кроме того, ингибиторы M2 действительно обладают значительными побочными эффектами и неэффективны против вирусов гриппа B. Несмотря на то, что вирусы гриппа могут довольно быстро развить устойчивость к отдельным NI, риск развития устойчивости ко всему классу лекарств маловероятен и ниже, чем к ингибиторам M2, о чем свидетельствует тот факт, что практически не было выявлено перекрестной устойчивости к осельтамивиру и занамивиру. 51 Для путешественников NI могут играть роль как в профилактике до, так и после контакта с подтвержденными данными, полученными как на животных моделях (мыши и хорьки), так и в испытаниях на людях. 52 NI обеспечивают защитную эффективность при превентивном использовании в ситуации вспышки или вскоре после появления первых клинических симптомов за счет сокращения продолжительности и тяжести симптоматического гриппа. 53 , 54 Кроме того, несколько наблюдательных исследований в период пандемии 2009 года показывают, что раннее лечение может снизить частоту госпитализаций и внутрибольничную смертность. 55 Некоторые считают использование НИ спорным, потому что почти все опубликованные исследования были профинансированы промышленностью, а сообщаемые эффекты, как правило, незначительны, и не было крупных рандомизированных контрольных испытаний, доказывающих эффективность постконтактного лечения. 53 , 54 Однако недавний независимый метаанализ показал, что осельтамивир у взрослых, больных гриппом, ускоряет облегчение клинических симптомов, снижает риск осложнений со стороны нижних дыхательных путей и госпитализации, одновременно увеличивая частоту тошноты и рвоты. . 56

Хотя NI имеют относительно легкие побочные эффекты, их стоимость и умеренная эффективность предполагают, что они должны играть лишь ограниченную роль в рутинных рекомендациях перед поездкой. Тем не менее, пожилым людям или другим группам высокого риска, в которых эффективность вакцины может быть низкой, можно посоветовать рассмотреть вопрос о привлечении NI для раннего лечения гриппа, если доступ к медицинской помощи в месте назначения будет ограничен. Тем более, что во многих странах NI требует, чтобы медицинский сценарий был приобретен, и он может быть недоступен, что приводит к ненужной задержке.Эти наркотики также могут использоваться в условиях общественного транспорта, например, в круизах или групповых поездках. Использование NI действительно приводит к сокращению продолжительности заболевания — если они используются в течение 48 часов после появления первых симптомов — примерно на 1 день — и к снижению тяжести заболевания, хотя это также является предметом дискуссий. 46 В определенных случаях такое сокращение может иметь решающее значение: например, спортсменов, политиков, ученых и тех, кто путешествует по делам. 57 Профилактическое использование НИ снижает вероятность заражения. 57 Насколько нам известно, и в свете недавних Олимпийских игр в Рио-де-Жанейро и предстоящих спортивных мероприятий, НВ в настоящее время не внесены в список запрещенных веществ Всемирным антидопинговым агентством (WADA) [https: //www.wada- ama.org/en/what-we-do/prohibited-list (26 октября 2016 г., дата последнего доступа)].

В настоящее время CDC предлагает лечить пациентов, инфицированных птичьим гриппом, осельтамивиром или занамивиром. Кроме того, лечебное использование НИ рекомендуется как можно раньше, предпочтительно в течение 48 часов, для пациентов, госпитализированных с подтвержденным или подозреваемым гриппом, с тяжелым, осложненным или прогрессирующим заболеванием или с высоким риском гриппозависимых осложнений (например,грамм. дети <2 лет, взрослые ≥65 лет, жители домов престарелых, лица с серьезными сопутствующими заболеваниями) в соответствии с рекомендациями CDC (www.cdc.gov/flu/professionals/antivirals/summary-clinician.htm). В настоящее время осельтамивир зарегистрирован FDA для лечения гриппа для любого возраста и для химиопрофилактики с 3-месячного возраста. Возрастной предел для приема занамивира в настоящее время составляет 7 и 5 лет соответственно. Профилактическое дозирование хлорохина, которое, как известно, обладает некоторой неспецифической противовирусной эффективностью in vitro, не привело к клинической защите в крупном рандомизированном контролируемом исследовании сообщества во время вспышки h2N1 в 2009 году и поэтому, похоже, не играет роли в медицине путешествий в отношении гриппа. профилактика. 58

Вакцинация здоровых путешественников с низким уровнем риска

В настоящее время вакцинация от сезонного гриппа в большинстве руководств рекомендуется только здоровым путешественникам, если они планируют посещать крупные мероприятия или путешествовать на круизном лайнере. Это главным образом связано с тем, что грипп считается относительно легким и самоизлечивающимся заболеванием у большинства здоровых людей. 2 Однако за последнее десятилетие неуклонно накапливались сообщения о пациентах без сопутствующих заболеваний, у которых развивается тяжелый и даже летальный грипп с явно «нормальными» вирусами сезонного гриппа. 7 , 32 , 36 , 37 , 59 , 60 . Поскольку сезонный грипп — наиболее частое инфекционное заболевание, которое можно предотвратить с помощью вакцинации, у путешественников, вакцинация против гриппа должна быть частью регулярных рекомендаций перед поездкой для всех путешественников. Это поднимает более общий вопрос о том, какое бремя ожидаемого заболевания во время предполагаемого путешествия могло бы оправдать включение рекомендаций по вакцинации в инструкции по поездкам.Вероятность заражения гриппом, тяжесть заболевания, ожидаемая эффективность вакцины и стоимость — это факторы, которые следует принимать во внимание. Можно утверждать, что a priori шансов заболеть брюшным тифом, гепатитом А или столбняком во время двух с половиной недель поездки в азиатское место назначения намного ниже, чем вероятность заражения вирусом гриппа. Однако, по крайней мере, согласно большинству руководств, выпущенных в промышленно развитых странах, эти три вакцинации обычно рекомендуются для большинства путешественников, направляющихся во многие развивающиеся страны, в то время как вакцинация против гриппа часто даже не рассматривается. 61

Вакцинация путешественников, принадлежащих к группам высокого риска

Большинство пожилых людей (≥60 или ≥65 лет) и лиц с серьезными сопутствующими заболеваниями могут быть кандидатами на вакцинацию против гриппа даже без планов на поездки. Тем не менее, по-прежнему важно оценить статус вакцинации и оценить, подходят ли штаммы, против которых человек был вакцинирован, для географической области и сезона планов поездки (см. Ниже).Рекомендации для пожилых людей основаны не только на неизбежно растущем числе сопутствующих заболеваний в этой возрастной группе, но и на иммунном старении. 62–64 К сожалению, эффективность противогриппозных вакцин часто снижается у лиц, которым вакцинация может принести наибольшую пользу: у лиц с ослабленным иммунитетом и пожилых людей, а также у пациентов из других групп высокого риска, упомянутых практически во всех рекомендациях. Имеются ограниченные данные о добавленной стоимости недавно представленных адъювантных, высокодозных (HD) и четырехвалентных вакцин (для обзора см. Reperant et al. 65 ). На сегодняшний день сильные данные РКИ, свидетельствующие о превосходстве, доступны только для препарата HD для пожилых людей, и эффект был умеренным. 66

Хотя раньше иммунизировать беременных женщин неохотно, в настоящее время вакцинация беременных против сезонного гриппа включена в большинство руководств и рекомендаций. Это основано на реальных рисках заражения гриппом во время беременности, которые намного превышают риски, связанные с вакцинацией.Во время пандемии h2N1 (2009 г.) вакцины против гриппа оказались безопасными и эффективными для беременных женщин и их будущих детей; результаты очень похожи на результаты исследований вакцинации против сезонного гриппа в этой группе высокого риска. 67 , 68 В соответствии с этими рекомендациями, рекомендации могут быть расширены для беременных женщин, путешествующих в районы, эндемичные по гриппу, и, возможно, для лиц, находящихся в тесном контакте с беременными женщинами или другими лицами высокого риска, такими как партнеры и близкие родственники. члены [Руководство CDC: http: // www.cdc.gov/h2n1flu/clinician_pregnant.htm (26 октября 2016 г., дата последнего доступа)] или партнеров по путешествиям.

Необходимо проверить вакцинацию против гриппа путешественников, относящихся к определенным категориям риска, и рекомендовать либо вакцинацию, либо дополнительную вакцинацию против гриппа на основе эпидемиологической ситуации в районе предполагаемой поездки. Относительно ограниченная эффективность вакцинации против гриппа в большинстве групп высокого риска и ценность новых поколений вакцин, которые могут решить эти проблемы, являются важными темами для будущих исследований.Наконец, для очень слабых пациентов совет не ездить в определенные районы всегда следует учитывать во время консультации перед поездкой, хотя оценка риска в этих случаях, очевидно, не должна ограничиваться угрозой, исходящей от гриппа.

Массовые собрания

Хадж, несомненно, является одним из самых сложных крупномасштабных мероприятий с точки зрения борьбы с инфекционными заболеваниями. Ежегодно более 10 миллионов паломников со всего мира посещают святые места ислама в Королевстве Саудовская Аравия.Почти одна треть этих паломников будет выполнять это религиозное обязательство в течение 6-дневного фиксированного периода, называемого хаджем. Остальные две трети будут совершать умру, которую можно совершать в любое время года с пиком посещаемости во время Рамадана. 69 Число паломников хаджа увеличилось в 5 раз с 1920 по 2012 год 70 и, в определенных «узких местах» паломничества, скопление людей может достигать 3-4 человек на квадратный метр. 71 В недавнем обширном обзоре, охватывающем 31 исследование, связанное с хаджем, инфекции дыхательных путей были, безусловно, наиболее распространенными инфекциями среди паломников, при этом 60% больных хаджем предъявляли жалобы на респираторные пути. 70 После риновируса вирусы гриппа являются наиболее частой причиной респираторных заболеваний. 72 , 73 Быстрый рост числа заболевших во время 6-дневного хаджа подтверждает условия, предрасполагающие к передаче гриппа во время этого паломничества. 73 Учитывая тяжелые последствия, которые грипп может иметь для групп высокого риска, и поскольку грипп в настоящее время является единственной инфекцией респираторного вируса, которую можно предотвратить с помощью вакцин, Министерство здравоохранения Королевства Саудовская Аравия рекомендует вакцинировать международных паломников от сезонного гриппа. с самыми последними доступными вакцинами. 70 , 74 , 75 Необходимость стремиться к оптимальному охвату вакцинацией паломников во время хаджа дополнительно подтверждается исследованиями, показывающими, что почти 50% паломников во время хаджа 2009 г. имели по крайней мере один риск. фактор развития тяжелого гриппа. 76 Несмотря на требование правительства Саудовской Аравии, недавнее поперечное исследование показало, что охват вакцинацией малазийских паломников составляет лишь 65,2%. 77 Конечно, немедикаментозные меры (например,грамм. гигиена рук, ношение масок и социальное дистанцирование) может еще больше снизить передачу гриппа во время хаджа, хотя результаты эффективности не всегда были убедительными. 78 Однако объединенные данные нескольких исследований показывают, что распространенность ГПЗ снизилась среди паломников в хадж, поскольку охват вакцинацией увеличился за последнее десятилетие. 79 Вспышки гриппа не очень часто регистрируются на других крупномасштабных религиозных, спортивных или культурных мероприятиях, но зарегистрированные примеры включают религиозный Всемирный день молодежи в Сиднее, Австралия, 2008 г., вспышки на музыкальных мероприятиях в 2009 г. в Бельгии, Венгрии и Сербии, и на зимних Олимпийских играх в Солт-Лейк-Сити в 2002 году. 59 , 60 , 80

Отпуск на круизном лайнере

Особое внимание следует уделять профилактике и лечению гриппа во время путешествий на круизных лайнерах в отпуск. Некоторые современные круизные лайнеры перевозят более 5000 пассажиров, обслуживаемых более чем 2000 членами экипажа, 81 , которые могут приехать и во время круиза также могут посещать несколько географических областей или даже путешествовать между полушариями. Часто по крайней мере некоторые пассажиры прибывают из той части мира, где наблюдается эпидемия гриппа.Экипажи этих судов могут служить резервуарами для вирусов гриппа между рейсами, поскольку они часто работают длительное время в течение сезона, контактируя с меняющимися группами пассажиров. За последние два десятилетия во многих отчетах описывались вспышки гриппа на круизных судах. Большинство из них были сезонными вспышками гриппа, которые произошли вне «традиционных» сезонов гриппа, характерных для регионов с умеренным климатом. 82 , 83 Недавний систематический обзор 41 исследования распространения респираторного вируса во время транспортировки и в транспортных узлах показал, что вспышки гриппа на круизных лайнерах обычно поражают 2–7% пассажиров. 84 После острого гастроэнтерита наиболее распространенным инфекционным заболеванием на борту судов является грипп. 85 В большинстве вспышек гриппа на круизных лайнерах члены экипажа подвергаются наибольшему риску заражения, вероятно, потому, что их жилые помещения более переполнены, что способствует распространению. 85 Хотя вспышка гриппа может произойти в любом круизе по всему миру, вспышки чаще всего регистрировались во время круизов на Аляску, Австралию / Транскотасман и Южную Америку. 86–98

Логично ожидать, что увеличение охвата вакцинацией против гриппа пассажиров и членов экипажа приведет к снижению бремени болезней.Однако несоответствие между циркулирующими и вакцинными штаммами, частично основанное на различиях между вакцинами для соответствующих полушарий, может снизить эффективность этой стратегии. Наряду со сниженным ответом пожилых людей и людей с ослабленным иммунитетом уровень защиты, обеспечиваемый увеличением охвата вакцинацией, может быть недостаточным для предотвращения вспышек 89 , и следует рассмотреть возможность применения других стратегий профилактики. В 2009 году ранее учрежденный проект Европейского союза (SHIPSAN) активно продвигал меры по предотвращению вспышек инфекционных заболеваний на пассажирских судах, уделяя особое внимание пандемии гриппа h2N1. 90 Были сообщения, описывающие успешное прекращение передачи гриппа на круизных лайнерах посредством введения комбинации мер, включая наблюдение, изоляцию и вакцинацию экипажа, в сочетании с антивирусной химиопрофилактикой как для экипажа, так и для пассажиров. 81

Скорее всего, из-за относительно низкой скорости морских путешествий по сравнению с путешествиями на самолетах на сегодняшний день нет никаких указаний на то, что морской транспорт ускоряет глобальное распространение гриппа. 84

Птичий грипп и туристическая медицина

Хотя случаи тяжелой инфекции вируса птичьего гриппа среди людей регистрировались в Азии с 1997 года, когда высокопатогенный (для домашней птицы) птичий грипп A H5N1 поразил 18 человек в Гонконге, 6 из которых умерли, 91–93 еще не Было много сообщений о птичьем гриппе у путешественников. Недавно был опубликован отчет о болезни 28-летней женщины из Канады, которая вернулась из Китая со смертельной пневмонией и менингоэнцефалитом, вызванным высокопатогенным (для домашней птицы) инфекцией птичьего гриппа A H5N1. 94 В другом отчете о случае описывается 59-летняя женщина, которая посетила птичий рынок в Южном Китае в качестве туриста, у которой развилась одышка и кровохарканье из-за тяжелой пневмонии, связанной с сочетанием инфекции H5N1 и микоплазмы. 95 Несмотря на то, что риск заражения птичьим гриппом относительно невелик, такие редкие, но часто смертельные инфекции у путешественников необходимо учитывать во время советов перед поездкой. Низкопатогенный (для домашней птицы) вирус птичьего гриппа H7N9 недавно появился в Китае и заразил сотни людей со летальностью около 20%. 6 , 74 Случаи H7N9, завезенные путешественниками, были зарегистрированы во многих странах за пределами Китая, где передача от птицы к человеку продолжается. 6 Пока передача от человека к человеку этих штаммов вируса птичьего гриппа является редкой, поэтому профилактика должна быть сосредоточена преимущественно на предотвращении контактов путешественников с домашней птицей и сырыми продуктами из птицы.

Профилактические меры и варианты лечения птичьего гриппа

Хотя птичий грипп встречается у людей только спорадически, с ограниченной передачей от птицы к человеку, профилактические меры действительно играют роль в снижении риска, связанного с опасностью для путешественников.В настоящее время вакцины от птичьего гриппа для людей отсутствуют в продаже. Следовательно, профилактика заражения вирусами птичьего гриппа должна быть сосредоточена на повышении осведомленности специалистов в области медицины путешествий и корректировке поведения путешественников с помощью рекомендаций перед поездкой. Особое внимание следует уделять путешественникам, планирующим посетить районы, эндемичные по птичьему гриппу среди домашних птиц и где были зарегистрированы случаи заболевания людей. Такие районы в настоящее время встречаются в Азии, Африке и на Ближнем Востоке. Консультации должны быть сосредоточены на избежании контактов с пациентами, страдающими респираторными заболеваниями, и контактов с птицами и их экскрементами на рынках или фермах, где живут живые птицы, а также на недопущении контактов и потребления недостаточно приготовленных продуктов из птицы.Поскольку потребление крови и сырого мяса птицы связано с передачей вируса от птицы к человеку, продукты из птицы для потребления человеком должны быть полностью приготовлены и, следовательно, не должны приобретаться у уличных торговцев. Посещение рынков живой птицы в эндемичных районах не рекомендуется, поскольку было доказано, что передача аэрозолей является фактором риска (т.е. заражение аэрозольными фекалиями домашней птицы). Общие меры гигиены, такие как мытье и дезинфекция рук, могут ограничить передачу вируса птичьего гриппа 6 , но имеются лишь ограниченные данные о прямой и косвенной передаче от птицы человеку и профилактике у лиц, совершающих поездки в районы, эндемичные по птичьему гриппу среди домашних птиц.Исследование, проведенное на основе анкетирования австралийских туристов, посещающих районы со вспышками птичьего вируса H5N1 среди домашних птиц, свидетельствует об их плохой осведомленности об этой инфекции. 96 , 97 Несмотря на то, что в настоящее время полагаются на такие общие профилактические меры, усилия по разработке вакцин для вирусов H5N1 и H7N9 продолжаются. 81 Однако эти усилия направлены не на разработку вакцин для путешествий, а, скорее, на обеспечение готовности к пандемии, поскольку вирусы птиц могут вызвать будущую пандемию из-за мутации или пересортировки. 3 , 4 Ввиду риска, создаваемого вирусами птичьего гриппа, раннее или, в определенных случаях, даже профилактическое использование противовирусных препаратов, таких как осельтамивир и перамивир, может спасти жизнь. Поскольку наличие сильнодействующих НВ в некоторых районах может быть ограничено, путешественникам с высокой вероятностью заражения, например птицеводам, ветеринарам или врачам, следует подумать о том, чтобы взять с собой эти лекарства.

Пандемический грипп и медицина для путешествий

Обобщенные данные и рекомендации по сезонному гриппу и медицине путешествий также применимы к пандемии гриппа.Однако во время пандемии международные и национальные органы здравоохранения выпустят руководящие принципы и рекомендации, в значительной степени основанные на имеющихся знаниях о штамме гриппа по мере его распространения. Как мы также узнали из пандемии гриппа 2009 г., рекомендации по вакцинации, использование противовирусных препаратов и целевые группы, вероятно, будут различаться в зависимости от пандемии, и поэтому следует предоставлять индивидуальные рекомендации. В этой ситуации также могут быть уместны рекомендации по путешествиям, связанным с конкретным штаммом, чтобы уменьшить распространение пандемического вируса воздушным транспортом, чтобы выиграть время для разработки и реализации мер вмешательства и стратегий смягчения последствий.

Наличие эффективных вакцин против гриппа — необходимые действия

ВОЗ рекомендует, чтобы «лица с высоким риском, путешествующие из одного полушария в другое незадолго до или во время сезона гриппа в другом полушарии, должны были пройти вакцинацию, рекомендованную для противоположного полушария, за две недели до поездки» [http://www.who.int/ ith / Vacines / Season_influenza / en / (26 октября 2016 г., дата последнего обращения)]. Однако соблюдение этой рекомендации во многом зависит от наличия соответствующей вакцины в стране проживания.К сожалению, даже в те годы, когда вакцины северного и южного полушария содержат идентичные штаммы, срок годности местной «вакцины против зимнего гриппа» обычно истекает, когда рассматривается вопрос о поездке, и ни вакцина следующего зимнего сезона, ни вакцина противоположного полушария недоступны (т. Е. имеет лицензию в стране отправления). Таким образом, если на месте нет подходящей вакцины против гриппа, путешественник должен организовать вакцинацию как можно скорее после прибытия в пункт назначения, учитывая, что для развития защиты, индуцированной вакциной, может потребоваться 1-2 недели. 98 Более того, вероятность того, что путешественники, прибывающие в краткосрочный отпуск, стремятся сделать прививку от гриппа в стране, которую они посещают, очень маловероятна. Этот подход может быть особенно важен в годы, когда произошли значительные изменения в рецептуре вакцин северного и южного полушария. Через несколько лет эта ситуация улучшится простым увеличением срока хранения вакцины против сезонного гриппа. Коммерческие вакцины часто сохраняют приемлемую активность в течение многих месяцев после «истечения срока годности».Кроме того, фармацевтическая промышленность и регулирующие органы должны приложить усилия к тому, чтобы вакцины против гриппа в противоположном полушарии были доступны, по крайней мере, для туристических клиник. Очевидно, что успех в разработке более универсальных противогриппозных вакцин, обеспечивающих более длительный срок действия и повышенную эффективность, принесет большие преимущества в борьбе с гриппом не только среди групп высокого риска, но и среди путешественников. 65 , 74

Исследования будущего

Учитывая воздействие и бремя болезней, вызванных гриппом, связанным с путешествиями, профилактика и лечение гриппа до и во время путешествия — это область медицины путешествий, которая привлекает больше внимания, чем сегодня.Текущие данные показывают, что охват вакцинацией путешественников может быть значительно улучшен. 79 , 99–101 Дальнейшие исследования должны быть сосредоточены как на более глубоком понимании эпидемиологических аспектов сезонного гриппа, так и на оптимизации стратегий вакцинации. Хотя ВОЗ рекомендует путешественникам, направляющимся в противоположное полушарие, пройти вакцинацию вакциной, содержащей штаммы, циркулирующие в их пункте назначения [http://www.who.int/ith/ITh3010chapter6 (26 октября 2016 г., дата последнего обращения)], этот совет является в настоящее время практически невозможно осуществить, кроме как посоветовать путешественникам пройти вакцинацию сразу по прибытии в пункт назначения.Увеличение срока хранения вакцин против сезонного гриппа может улучшить ситуацию в годы, когда штаммы не меняются между северными и южными составами, но следует также применять другие стратегии, такие как обеспечение глобального лицензирования сезонных вакцин и разработка более универсальных вакцин. Повышение эффективности вакцин против сезонного гриппа принесет особую пользу очень молодым и пожилым, а также людям с ослабленным иммунитетом, поскольку эффективность вакцины по-прежнему далека от удовлетворительной в этих группах высокого риска.Хотя на сегодняшний день зарегистрированы только спорадические случаи птичьего гриппа, связанного с путешествиями, эти инфекции обычно тяжелы и часто приводят к летальному исходу. Ввиду отсутствия зарегистрированных вакцин против птичьего гриппа и ввиду их спорадического и географически ограниченного характера профилактические меры должны быть сосредоточены на адекватных рекомендациях перед поездкой для снижения заражения. Наконец, необходимо уделять больше внимания доступности конкретных противовирусных препаратов для раннего лечения или профилактики сезонного и птичьего гриппа у путешественников, и это должно быть отражено в (международных) национальных руководствах.

Выводы

Сезонный грипп — серьезная проблема для путешественников, которую следует регулярно решать при предварительном консультировании и дифференциальной диагностике любого возвращающегося путешественника с лихорадкой. Мы стремились предоставить обзор доступной литературы и руководств. Потенциальные ограничения этого обзора могут быть связаны с руководящими принципами, недоступными на английском языке или доступными для нашей поисковой стратегии. Однако, основываясь на доступной литературе, мы считаем, что профилактика и лечение гриппа до и во время путешествия — это область медицины путешествий, которая требует большего внимания, чем сегодня.Консультации экспертов о профилактических гигиенических и поведенческих мерах, вакцинации и вариантах противовирусного лечения должны стать рутинными элементами консультирования перед поездкой. Вакцинация против сезонного гриппа должна быть настоятельно рекомендована людям из групп высокого риска, таких как пожилые люди и люди с ослабленным иммунитетом, для которых такие защитные меры уже являются частью стандартных рекомендаций для лиц, не путешествующих в большинстве юрисдикций (Таблица 1). Также следует рассмотреть возможность плановой иммунизации здоровых партнеров по путешествиям этих людей из группы высокого риска.Многие также рекомендуют вакцинацию от гриппа всем путешественникам и членам экипажа круизных лайнеров, а также путешественникам, собирающимся на крупные религиозные собрания и другие массовые мероприятия. 74 Кроме того, вакцинация против гриппа может быть рассмотрена для любого международного путешественника, желающего снизить личный риск потери трудоспособности из-за гриппа во время путешествия. Помимо вакцинации против гриппа, путешественники могут быть проинформированы о других средствах снижения риска гриппа и его передачи, например о применении гигиенических и поведенческих мер и вариантах быстрого противовирусного лечения.

Таблица 1

Краткое изложение имеющихся руководств по вакцинации против гриппа в медицине путешествий

, Германия , дата последнего обращения , дата последнего обращения , дата последнего обращения , Германия , дата последнего обращения //www.dtg.org/influenzasaisonal.html (26 октября 2016 г., дата последнего обращения) /www.mijnlcr.nl (26 октября 2016 г., дата последнего доступа)
Орган . Высокий риск . Нормальный риск . Источник .
Австралия Рекомендуется Рассмотреть http://www.immunise.health.gov.au/internet/immunise/publishing.nsf/Content/Handbook10-home∼handbook10part3∼handbook10-3-2 (26 октября 2016 г., дата последнего доступа)
Правительство Австрии не упоминается не упоминается https: // www.gesundheit.gv.at/Portal.Node/ghp/public/content/Reiseimpfungen_LN.html (26 октября 2016 г., дата последнего обращения)
Austria Travel Medicine Рекомендовано Рекомендовано http: //www.reisemed .at / krankheiten / influenza-echte-grippe (26 октября 2016 г., дата последнего обращения)
Франция Рекомендуется не упоминается http://www.invs.sante.fr/beh/2015/reco /pdf/2015_reco.pdf
Германия CRM Упомянутый Упомянутый https: // www.crm.de/krankheiten/krankheiten.asp?Domain=CRM&Sprache=de&Bereich=krankheiten&Klientel=laie&Auspraegung=kurz&HTMLfragmente=no&Auswahl=AZ (26 октября 2016 г., дата последнего обращения
Швейцария Рекомендуется Не упоминается http: //www.safetravel.ch / safetravel2 / servlet / ch.ofac.wv.wv204j.pages.Wv204ConseilsSanteListeCtrl? action = afficheDetail & elementCourant = 0 (26 октября 2016 г., дата последнего обращения)
Нидерланды Нидерланды 9057 Не рекомендуется
Великобритания Вакцина для южного полушария недоступна. Проконсультируйтесь с врачом. Не упоминается (страница о гриппе на сайте NaTHNaC отсутствует) http: // travelhealthpro.org.uk/olympic-and-paralympic-games-2016-brazil/ (26 октября 2016 г., дата последнего обращения)
Канада Не рекомендуется Не рекомендуется http: //www.phac-aspc. gc.ca/publicat/cig-gci/p03-10-eng.php (26 октября 2016 г., дата последнего обращения)
США Рекомендуется Рекомендуется http://wwwnc.cdc.gov/ путешествия / болезни / грипп-сезонный-зоонозный-и-пандемический (26 октября 2016 г., дата последнего обращения)
Всемирная организация здравоохранения Необходимо вакцинировать не упоминается http: // www.who.int/ith/vaccines/seasonal_influenza/en/ (26 октября 2016 г., дата последнего доступа)
Королевство Саудовская Аравия Необходимо вакцинировать a Необходимо вакцинировать a http: / /www.moh.gov.sa/en/Hajj/Pages/HealthRegulations.aspx (26 октября 2016 г., дата последнего обращения)
Бразилия См. рекомендации ВОЗ См. рекомендации ВОЗ http: // portalsaude.saude.gov.br/index.php / o-Ministerio / Principal / leia-mais-o-Ministerio / 440-secretaria-svs / viajante / viajante-en / 9654-brazilians-foreign (26 октября 2016 г., дата последнего доступа)
Южная Африка Нет указаний по проезду b Нет указаний по проезду b
Орган . Высокий риск . Нормальный риск . Источник .
Австралия Рекомендуется Рассмотреть http://www.immunise.health.gov.au/internet/immunise/publishing.nsf/Content/Handbook10-home∼handbook10part3∼handbook10-3-2 (26 октября 2016 г., дата последнего доступа)
Правительство Австрии не упоминается не упоминается https://www.gesundheit.gv.at/Portal.Node/ghp/public/content/Reiseimpfungen_LN.html (26 октября 2016 г., дата последнего обращения)
Austria Travel Medicine Рекомендуется Рекомендуется http: // www.reisemed.at/krankheiten/influenza-echte-grippe (26 октября 2016 г., дата последнего обращения)
Франция Рекомендуется не упоминается http://www.invs.sante.fr/beh/2015/ reco / pdf / 2015_reco.pdf
Германия CRM Упомянутая Упомянутая https://www.crm.de/krankheiten/krankheiten.asp?Domain=CRM&Sprachez&HTELERAD=ru&Sprache=deran&hl=ru&Spratemen&html?hl=ru&Sprache=deran&hl=ru = AZ (26 октября 2016 г., дата последнего обращения)
Германия DTG Рекомендовано Полезно http: // www.dtg.org/influenzasaisonal.html (26 октября 2016 г., дата последнего обращения)
Швейцария Рекомендуется Не упоминается http://www.safetravel.ch/safetravel2/servlet/ch.ofac.wv. wv204j.pages.Wv204ConseilsSanteListeCtrl? action = afficheDetail & elementCourant = 0 (26 октября 2016 г., дата последнего обращения)
Нидерланды Рекомендуется Не рекомендуется http://www.nljnlcr.date (26 октября 2016 г., октябрь 2016 г., 26 октября 2016 г., дата последнего обращения) (26 октября 2016 г., дата последнего обращения) последний доступ)
Великобритания Вакцина для южного полушария недоступна.Проконсультируйтесь с врачом. Не упоминается (страница о гриппе на сайте NaTHNaC отсутствует) http://travelhealthpro.org.uk/olympic-and-paralympic-games-2016-brazil/ (26 октября 2016 г., дата последнего доступа)
Канада Не рекомендуется Не рекомендуется http://www.phac-aspc.gc.ca/publicat/cig-gci/p03-10-eng.php (26 октября 2016 г., дата последнего обращения)
США Рекомендуется Рекомендуется http: // wwwnc.cdc.gov/travel/diseases/influenza-seasonal-zoonotic-and-pandemic (26 октября 2016 г., дата последнего доступа)
Всемирная организация здравоохранения Следует вакцинировать не упоминается http: // www. who.int/ith/vaccines/seasonal_influenza/en/ (26 октября 2016 г., дата последнего доступа)
Королевство Саудовская Аравия Необходимо вакцинировать a Необходимо вакцинировать a http: / / www.moh.gov.sa/en/Hajj/Pages/HealthRegulations.aspx (26 октября 2016 г., дата последнего обращения)
Бразилия См. рекомендации ВОЗ См. рекомендации ВОЗ http: //portalsaude.saude .gov.br / index.php / o-Ministerio / Principal / leia-mais-o-Ministerio / 440-secretaria-svs / viajante / viajante-en / 9654-brazilians-foreign (26 октября 2016 г., дата последнего обращения)
Южная Африка Нет руководств по поездкам b Нет руководств по поездкам b
Таблица 1

Краткое изложение имеющихся руководств по вакцинации против гриппа в медицине путешествий

, Германия , дата последнего обращения , дата последнего обращения , дата последнего обращения , Германия , дата последнего обращения //www.dtg.org/influenzasaisonal.html (26 октября 2016 г., дата последнего обращения) /www.mijnlcr.nl (26 октября 2016 г., дата последнего доступа)
Власти . Высокий риск . Нормальный риск . Источник .
Австралия Рекомендуется Рассмотреть http://www.immunise.health.gov.au/internet/immunise/publishing.nsf/Content/Handbook10-home∼handbook10part3∼handbook10-3-2 (26 октября 2016 г., дата последнего доступа)
Правительство Австрии не упоминается не упоминается https: // www.gesundheit.gv.at/Portal.Node/ghp/public/content/Reiseimpfungen_LN.html (26 октября 2016 г., дата последнего обращения)
Austria Travel Medicine Рекомендовано Рекомендовано http: //www.reisemed .at / krankheiten / influenza-echte-grippe (26 октября 2016 г., дата последнего обращения)
Франция Рекомендуется не упоминается http://www.invs.sante.fr/beh/2015/reco /pdf/2015_reco.pdf
Германия CRM Упомянутый Упомянутый https: // www.crm.de/krankheiten/krankheiten.asp?Domain=CRM&Sprache=de&Bereich=krankheiten&Klientel=laie&Auspraegung=kurz&HTMLfragmente=no&Auswahl=AZ (26 октября 2016 г., дата последнего обращения
Швейцария Рекомендуется Не упоминается http: //www.safetravel.ch / safetravel2 / servlet / ch.ofac.wv.wv204j.pages.Wv204ConseilsSanteListeCtrl? action = afficheDetail & elementCourant = 0 (26 октября 2016 г., дата последнего обращения)
Нидерланды Нидерланды 9057 Не рекомендуется
Великобритания Вакцина для южного полушария недоступна. Проконсультируйтесь с врачом. Не упоминается (страница о гриппе на сайте NaTHNaC отсутствует) http: // travelhealthpro.org.uk/olympic-and-paralympic-games-2016-brazil/ (26 октября 2016 г., дата последнего обращения)
Канада Не рекомендуется Не рекомендуется http: //www.phac-aspc. gc.ca/publicat/cig-gci/p03-10-eng.php (26 октября 2016 г., дата последнего обращения)
США Рекомендуется Рекомендуется http://wwwnc.cdc.gov/ путешествия / болезни / грипп-сезонный-зоонозный-и-пандемический (26 октября 2016 г., дата последнего обращения)
Всемирная организация здравоохранения Необходимо вакцинировать не упоминается http: // www.who.int/ith/vaccines/seasonal_influenza/en/ (26 октября 2016 г., дата последнего доступа)
Королевство Саудовская Аравия Необходимо вакцинировать a Необходимо вакцинировать a http: / /www.moh.gov.sa/en/Hajj/Pages/HealthRegulations.aspx (26 октября 2016 г., дата последнего обращения)
Бразилия См. рекомендации ВОЗ См. рекомендации ВОЗ http: // portalsaude.saude.gov.br/index.php / o-Ministerio / Principal / leia-mais-o-Ministerio / 440-secretaria-svs / viajante / viajante-en / 9654-brazilians-foreign (26 октября 2016 г., дата последнего доступа)
Южная Африка Нет указаний по проезду b Нет указаний по проезду b
Орган . Высокий риск . Нормальный риск . Источник .
Австралия Рекомендуется Рассмотреть http://www.immunise.health.gov.au/internet/immunise/publishing.nsf/Content/Handbook10-home∼handbook10part3∼handbook10-3-2 (26 октября 2016 г., дата последнего доступа)
Правительство Австрии не упоминается не упоминается https://www.gesundheit.gv.at/Portal.Node/ghp/public/content/Reiseimpfungen_LN.html (26 октября 2016 г., дата последнего обращения)
Austria Travel Medicine Рекомендуется Рекомендуется http: // www.reisemed.at/krankheiten/influenza-echte-grippe (26 октября 2016 г., дата последнего обращения)
Франция Рекомендуется не упоминается http://www.invs.sante.fr/beh/2015/ reco / pdf / 2015_reco.pdf
Германия CRM Упомянутая Упомянутая https://www.crm.de/krankheiten/krankheiten.asp?Domain=CRM&Sprachez&HTELERAD=ru&Sprache=deran&hl=ru&Spratemen&html?hl=ru&Sprache=deran&hl=ru = AZ (26 октября 2016 г., дата последнего обращения)
Германия DTG Рекомендовано Полезно http: // www.dtg.org/influenzasaisonal.html (26 октября 2016 г., дата последнего обращения)
Швейцария Рекомендуется Не упоминается http://www.safetravel.ch/safetravel2/servlet/ch.ofac.wv. wv204j.pages.Wv204ConseilsSanteListeCtrl? action = afficheDetail & elementCourant = 0 (26 октября 2016 г., дата последнего обращения)
Нидерланды Рекомендуется Не рекомендуется http://www.nljnlcr.date (26 октября 2016 г., октябрь 2016 г., 26 октября 2016 г., дата последнего обращения) (26 октября 2016 г., дата последнего обращения) последний доступ)
Великобритания Вакцина для южного полушария недоступна.Проконсультируйтесь с врачом. Не упоминается (страница о гриппе на сайте NaTHNaC отсутствует) http://travelhealthpro.org.uk/olympic-and-paralympic-games-2016-brazil/ (26 октября 2016 г., дата последнего доступа)
Канада Не рекомендуется Не рекомендуется http://www.phac-aspc.gc.ca/publicat/cig-gci/p03-10-eng.php (26 октября 2016 г., дата последнего обращения)
США Рекомендуется Рекомендуется http: // wwwnc.cdc.gov/travel/diseases/influenza-seasonal-zoonotic-and-pandemic (26 октября 2016 г., дата последнего доступа)
Всемирная организация здравоохранения Следует вакцинировать не упоминается http: // www. who.int/ith/vaccines/seasonal_influenza/en/ (26 октября 2016 г., дата последнего доступа)
Королевство Саудовская Аравия Необходимо вакцинировать a Необходимо вакцинировать a http: / / www.moh.gov.sa/en/Hajj/Pages/HealthRegulations.aspx (26 октября 2016 г., дата последнего обращения)
Бразилия См. рекомендации ВОЗ См. рекомендации ВОЗ http: //portalsaude.saude .gov.br / index.php / o-Ministerio / Principal / leia-mais-o-Ministerio / 440-secretaria-svs / viajante / viajante-en / 9654-brazilians-foreign (26 октября 2016 г., дата последнего обращения)
Южная Африка Нет инструкций по проезду b Нет инструкций по поездкам b

Конфликт интересов: Не объявлен.

Список литературы

1

Clark

NM

Lynch

JP.

Грипп: эпидемиология, клиника, терапия и профилактика

.

Semin Respir Crit Care Med

2011

;

32

:

373

92

,2

Николсон

кг

Вуд

JM

Zambon

M.

Influenza

.

Ланцет

2003

;

362

:

1733

45

.3

Herfst

S

Schrauwen

EJ

Linster

M

et al. .

Передача вируса гриппа A / H5N1 воздушным путем между хорьками

.

Наука

2012

;

336

:

1534

41

.4

Imai

M

Watanabe

T

Hatta

M

et al. .

Экспериментальная адаптация HA гриппа H5 передает респираторно-капельную передачу реассортантному вирусу H5 HA / h2N1 у хорьков

.

Природа

2012

;

486

:

420

8

,5

Liem

NT

Tung

CV

Hien

ND

et al. .

Клинические особенности инфекции человеческого гриппа A (H5N1) во Вьетнаме: 2004–2006 годы

.

Clin Infect Dis

2009

;

48

:

1639

46

,6

Lazarus

R

Lim

PL.

Птичий грипп: недавняя эпидемиология, риски, связанные с поездками, и лечение

.

Curr Infect Dis Rep

2015

;

17

:

456.

7

Баутиста

E

Chotpitayasunondh

T

Gao

Z

et al. .

Клинические аспекты пандемической инфекции вируса гриппа A (h2N1) 2009

.

N Engl J Med

2010

;

362

:

1708

19

,8

Thomas

RE

Jefferson

T

Lasserson

TJ.

Вакцинация против гриппа медицинских работников, ухаживающих за людьми в возрасте 60 лет и старше, проживающими в учреждениях длительного ухода

.

Кокрановская база данных Syst Rev

2016

;

6

:

CD005187

.9

Remschmidt

C

Wichmann

O

Harder

T.

Вакцины для профилактики сезонного гриппа у пациентов с диабетом

: системный анализ .

BMC Med

2015

;

13

:

53.

10

Beck

CR

McKenzie

BC

Hashim

AB

et al. .

Вакцинация против гриппа для пациентов с ослабленным иммунитетом: резюме систематического обзора и метаанализа. Грипп

.

Другие вирусы Respir

2013

;

7

:

72

5

.11

Steffen

R

Behrens

RH

Hill

DR

et al..

Риски для здоровья в поездках, предотвращаемые с помощью вакцин: каковы доказательства — каковы пробелы?

.

J Travel Med

2015

;

22

:

1

12

.12

Hirve

S

Newman

LP

Paget

J

et al. .

Сезонность гриппа в тропиках и субтропиках — когда проводить вакцинацию?

PLoS One

2016

;

11

:

e0153003.

13

Бедфорд

T

Riley

S

Barr

IG

et al..

Характер глобальной циркуляции вирусов сезонного гриппа зависит от антигенного дрейфа

.

Природа

2015

;

523

:

217

20

.14

Russell

CA

Jones

TC

Barr

IG

et al. .

Мировая циркуляция вирусов сезонного гриппа A (h4N2)

.

Наука

2008

;

320

:

340

6

.15

Neatherlin

J

Cramer

EH

Dubray

C

et al. .

Грипп A (h2N1) pdm09 во время авиаперелета

.

Travel Med Infect Dis

2013

;

11

:

110

8

.16

Foxwell

AR

Roberts

L

Lokuge

K

et al. .

Передача гриппа международными рейсами, май 2009 г.

.

Emerg Infect Dis

2011

;

17

:

1188

94

,17

Kim

JH

Lee

DH

Shin

SS

et al. .

Передача нового гриппа A (h2N1) во время полета

.

Эпидемиол. Здоровье

2010

;

32

:

e2010006.

18

Leitmeyer

K

Adlhoch

C.

Передача гриппа на самолетах: систематический обзор литературы

.

Эпидемиология

2016

;

27

:

743

51

,19

Baker

MG

Thornley

CN

Mills

C

et al. .

Передача пандемического гриппа A / h2N1 2009 на пассажирских самолетах: ретроспективное когортное исследование

.

BMJ

2010

;

340

:

c2424.

20

Гупта

JK

Lin

CH

Chen

Q.

Оценка риска воздушных инфекционных заболеваний в кабинах самолетов

.

Внутренний воздух

2012

;

22

:

388

95

,21

Хан

K

Arino

J

Hu

W

et al. .

Распространение нового вируса гриппа A (h2N1) через международные авиалинии

.

N Engl J Med

2009

;

361

:

212

4

.22

Belderok

SM

Rimmelzwaan

GF

van den Hoek

A

et al. .

Влияние путешествий на эпидемиологию гриппа

.

Emerg Infect Dis

2013

;

19

:

925

31

.23

Whelan

J

Rimmelzwaan

GF

van den Hoek

A

et al. .

Грипп у голландцев, долгое время путешествующих по тропикам: симптомы и инфекции

.

BMC Infect Dis

2016

;

16

:

158.

24

Boggild

AK

Castelli

F

Gautret

P

et al. .

Широта перемещений среди вернувшихся путешественников с гриппом: результаты сети наблюдения GeoSentinel, 1997–2007 годы

.

J Travel Med

2012

;

19

:

4

8

.25

Mutsch

M

Tavernini

M

Marx

A

et al..

Инфекция вирусом гриппа у лиц, совершающих поездки в тропические и субтропические страны

.

Clin Infect Dis

2005

;

40

:

1282

7

.26

Follin

P

Lindqvist

A

Nystrom

K

et al. .

Различные респираторные вирусы, обнаруженные у путешественников с симптомами, возвращающихся из стран, где продолжается распространение нового штамма вируса гриппа A (h2N1) v

.

Euro Surveill

2009

;

14

: 1

3

.27

Jaureguiberry

S

Boutolleau

D

Grandsire

E

et al. .

Клиническая и микробиологическая оценка инфекций дыхательных путей, связанных с путешествиями, у путешественников, возвращающихся из стран, затронутых пандемией гриппа A (h2N1) 2009

.

J Travel Med

2012

;

19

:

22

7

.28

Odolini

S

Parola

P

Gkrania-Klotsas

E

et al. .

Завозные инфекции, связанные с путешествиями, в Европе, EuroTravNet 2009

.

Clin Microbiol Infect

2012

;

18

:

468

74

,29

Costantino

C

Vitale

F.

Вакцинация против гриппа в группах высокого риска: пересмотр существующих руководств и обоснование научно обоснованных профилактических мер стратегия

.

J Prev Med Hyg

2016

;

57

:

E13

8

.30

Ison

MG.

Профилактика и лечение гриппа у реципиентов трансплантата и хозяев с ослабленным иммунитетом. Грипп

.

Другие вирусы Respir

2013

;

7

:

60

6

.31

Саней

F

Wilkinson

T.

Вакцинация против гриппа для пациентов с хронической обструктивной болезнью легких: понимание иммуногенности, эффективности и эффективности

.

Ther Adv Respir Dis

2016

;

10

:

349

67

.32

Seki

M

Fuke

R

Oikawa

N

et al. .

Связь гриппа с тяжелой пневмонией / эмпиемой в сообществе, больнице и учреждениях здравоохранения

.

Respir Med Case Rep

2016

;

19

:

1

4

,36

Tomas

J

Macario

MC

Gaspar

E

et al..

Тяжелый постгриппозный (h2N1) энцефалит с поражением легочных ядер у взрослого пациента

.

BMJ Case Rep

2015

;

22

:

2015

.37

Shah

NS

Greenberg

JA

McNulty

MC

et al. .

Бактериальные и вирусные сопутствующие инфекции, осложняющие тяжелый грипп: заболеваемость и влияние среди 507 пациентов в США, 2013–14 гг.

.

J Clin Virol

2016

;

80

:

12

9

.38

Suess

T

Remschmidt

C

Schink

SB

et al. .

Роль лицевых масок и гигиены рук в профилактике передачи гриппа в домашних хозяйствах: результаты кластерного рандомизированного исследования; Берлин, Германия, 2009–2011 гг.

.

BMC Infect Dis

2012

;

12

:

26.

39

Кожух

BJ

Chan

KH

Клык

VJ

et al..

Лицевые маски и гигиена рук для предотвращения передачи гриппа в домохозяйствах: кластерное рандомизированное исследование

.

Ann Intern Med

2009

;

151

:

437

46

.40

Wong

VW

Кожух

BJ

Aiello

AE.

Гигиена рук и риск заражения вирусом гриппа в обществе: систематический обзор и метаанализ

.

Epidemiol Infect

2014

;

142

:

922

32

.41

Willmott

M

Nicholson

A

Busse

H

et al. .

Эффективность вмешательств по гигиене рук в сокращении случаев отсутствия по болезни среди детей в образовательных учреждениях: систематический обзор и метаанализ

.

Arch Dis Child

2016

;

101

:

42

50

.42

Aiello

AE

Coulborn

RM

Aragon

TJ

et al..

Результаты нефармацевтических интервенционных исследований пандемического гриппа и существующие пробелы в исследованиях

.

Am J Infect Control

2010

;

38

:

251

8

.43

Godoy

P

Castilla

J

Delgado-Rodriguez

M

et al. .

Эффективность гигиены рук и предоставление информации для предотвращения случаев гриппа, требующих госпитализации

.

Предыдущая Med

2012

;

54

:

434

9

.44

Torner

N

Soldevila

N

Garcia

JJ

et al. .

Эффективность немедикаментозных мер в профилактике детского гриппа: исследование случай-контроль

.

BMC Public Health

2015

;

15

:

543.

45

Aiello

AE

Murray

GF

Perez

V

et al..

Использование масок, гигиена рук и сезонное гриппоподобное заболевание среди молодых людей: рандомизированное интервенционное исследование

.

J Infect Dis

2010

;

201

:

491

8

.46

Барашид

O

Альфелали

M

Mushta

S

et al. .

Распространение и эффективность масок против респираторных инфекций при массовых собраниях: систематический обзор

.

Int J Infect Dis

2016

;

47

:

105

11

.47

Bin-Reza

F

Lopez Chavarrias

V

Nicoll

A

et al. .

Использование масок и респираторов для предотвращения передачи гриппа: систематический обзор научных данных

.

Другие респираторы гриппа

2012

;

6

:

257

67

.48

Fraser

C

Riley

S

Anderson

RM

et al..

Факторы, позволяющие контролировать вспышку инфекционного заболевания

.

Proc Natl Acad Sci U S A

2004

;

101

:

6146

51

.49

Loregian

A

Mercorelli

B

Nannetti

G

et al. .

Противовирусные стратегии против вируса гриппа: к новым терапевтическим подходам

.

Cell Mol Life Sci

2014

;

71

:

3659

83

.50

Глезен

WP.

Клиническая практика. Профилактика и лечение сезонного гриппа

.

N Engl J Med

2008

;

359

:

2579

85

.51

Spanakis

N

Pitiriga

V

Gennimata

V

et al. .

Обзор чувствительности к ингибиторам нейраминидазы у штаммов гриппа

.

Expert Rev Anti Infect Ther

2014

;

12

:

1325

36

.52

Oh

DY

Lowther

S

McCaw

JM

et al. .

Оценка схем профилактики осельтамивиром для снижения инфицирования вирусом гриппа, передачи и тяжести заболевания на модели домашнего контакта с хорьком

.

J Antimicrob Chemother

2014

;

69

:

2458

69

.53

Jefferson

T

Jones

M

Doshi

P

et al..

Ингибиторы нейраминидазы для профилактики и лечения гриппа у здоровых взрослых

.

Кокрановская база данных Syst Rev

2010

;

CD001265

.54

Jefferson

T

Jones

MA

Doshi

P

et al. .

Ингибиторы нейраминидазы для профилактики и лечения гриппа у здоровых взрослых и детей

.

Кокрановская база данных Syst Rev

2014

;

CD008965

.55

Beck

CR

Sokal

R

Arunachalam

N

et al. .

Ингибиторы нейраминидазы при гриппе: обзор и перспективы общественного здравоохранения после пандемии 2009 г.

.

Другие респираторы гриппа

2013

;

7 (Suppl 1)

:

14

24

.56

Dobson

J

Whitley

RJ

Pocock

S

et al..

Осельтамивир для лечения гриппа у взрослых: метаанализ рандомизированных контролируемых исследований

.

Ланцет

2015

;

385

:

1729

37

.57

Heneghan

CJ

Onakpoya

I

Jones

MA

et al. .

Ингибиторы нейраминидазы при гриппе: систематический обзор и метаанализ нормативных данных и данных о смертности

.

Оценка медицинских технологий

2016

;

20

:

1

242

.58

Paton

NI

Lee

L

Xu

Y

et al. .

Хлорохин для профилактики гриппа: рандомизированное двойное слепое плацебо-контролируемое исследование

.

Lancet Infect Dis

2011

;

11

:

677

83

.59

Alqahtani

AS

Alfelali

M

Arbon

P

et al. .

Бремя болезней, предупреждаемых с помощью вакцин, на крупных мероприятиях

.

Вакцина

2015

;

33

:

6552

63

.60

Ботельо-Невер

E

Gautret

P.

Вспышки, связанные с крупными фестивалями под открытым небом, включая музыкальные фестивали, с 1980 по 2012 год

.

Euro Surveill

2013

;

18

:

20426.

61

Freedman

D

Chen

LH

Kozarsky

P.

Медицинские соображения перед международной поездкой

.

N Engl J Med

2016

;

375

:

247

60

.62

Гнанасекаран

G

Биденбендер

R

Davidson

HE

et al. .

Прививки для пожилых людей

.

Clin Geriatr Med

2016

;

32

:

609

25

.63

McElhaney

JE

Kuchel

GA

Zhou

X

et al..

Т-клеточный иммунитет к гриппу у пожилых людей: патофизиологическая основа для разработки более эффективных вакцин

.

Фронт Иммунол

2016

;

7

:

41.

64

Домингес

A

Soldevila

N

Toledo

D

et al. .

Факторы, связанные с вакцинацией против гриппа госпитализированных пожилых пациентов в Испании

.

PLoS One

2016

;

11

:

e0147931.

65

Reperant

LA

Rimmelzwaan

GF

Osterhaus

AD.

Успехи в вакцинации против гриппа

.

F1000Prime Rep

2014

;

6

:

47.

66

DiazGranados

CA

Dunning

AJ

Kimmel

M

et al. .

Эффективность высоких доз вакцины против гриппа по сравнению со стандартной дозой у пожилых людей

.

N Engl J Med

2014

;

371

:

635

45

.67

Mutsaerts

E

Madhi

SA

Cutland

CL

et al. .

Вакцинация беременных женщин против гриппа защищает их в течение двух последовательных сезонов гриппа в рандомизированном контролируемом исследовании

.

Expert Rev Vaccines

2016

;

6

:

1

8

.68

Omer

SB

Bednarczyk

R

Madhi

SA

et al..

Преимущества вакцинации матери и ребенка от гриппа во время беременности

.

Hum Vaccin Immunother

2012

;

8

:

130

7

0,69

Memish

ZA

Zumla

A

Alhakeem

RF

et al. .

Хадж: наблюдение и контроль за инфекционными заболеваниями

.

Ланцет

2014

;

383

:

2073

82

.70

Gautret

P

Benkouiten

S

Al-Tawfiq

JA

et al. .

Вирусные респираторные инфекции, связанные с хаджем: систематический обзор

.

Travel Med Infect Dis

2016

;

14

:

92

109

.71

Memish

ZA

Ahmed

QA.

Мекка: вызовы впереди

.

J Travel Med

2002

;

9

:

202

10

.72

Benkouiten

S

Charrel

R

Belhouchat

K

et al. .

Распространение респираторных вирусов среди паломников во время паломничества хаджа 2012

.

Clin Infect Dis

2013

;

57

:

992

1000

,73

Аннан

A

Овусу

M

Marfo

KS

et al. .

Высокая распространенность обычных респираторных вирусов и отсутствие свидетельств коронавируса ближневосточного респираторного синдрома у паломников хаджа, возвращающихся в Гану, 2013 г.

.

Trop Med Int Health

2015

;

20

:

807

12

,74

Состояние здоровья путешественников в Саудовскую Аравию для паломничества в Мекку (хадж), 2015 г.

.

Wkly Epidemiol Rec

2015

;

90

:

381

4

,75

Gautret

P

Benkouiten

S

Al-Tawfiq

JA

et al. .

Спектр респираторных возбудителей у вернувшихся паломников хаджа: мифы и реальность

.

Int J Infect Dis

2016

;

47

:

83

5

.76

Gautret

P

Parola

P

Brouqui

P.

Факторы риска для осложнений паломничества при гриппе H2N1 9000 в 2009 г.

Ланцет

2010

;

375

:

199

200

.77

Хашим

S

Ayub

ZN

Mohamed

Z

et al..

Распространенность и меры профилактики респираторных заболеваний среди паломников из Малайзии в сезон хаджа 2013 г.

.

J Travel Med

2016

;

23

:

tav019.

78

Benkouiten

S

Brouqui

P

Gautret

P.

Немедикаментозные вмешательства для профилактики инфекций дыхательных путей во время паломничества в хадж

.

Travel Med Infect Dis

2014

;

12

:

429

42

.79

Альфелали

M

Барашид

O

Ташани

M

et al. .

Изменения в распространенности гриппоподобных заболеваний и вакцинации против гриппа среди паломников, совершающих хадж: ретроспективный анализ данных за 10 лет

.

Вакцина

2015

;

33

:

2562

9

.80

Gautret

P

Steffen

R.

Инфекционные болезни как риск для здоровья при массовых собраниях, помимо хаджа: каковы доказательства?

Int J Infect Dis

2016

;

47

:

46

52

.81

Millman

AJ

Kornylo

DK

Lafond

K

et al. .

Вспышки гриппа среди пассажиров и членов экипажа двух круизных лайнеров: недавний отчет о готовности и ответных действиях на вездесущий вызов

.

J Travel Med

2015

;

22

:

306

11

.82

Грипп

B.

Вспышка вируса на круизном лайнере — Северная Европа, 2000

.

MMWR Morb Mortal Wkly Rep

2001

;

50

:

137

40

.83

Fernandes

EG

de Souza

PB

de Oliveira

ME

et al. .

Вспышка гриппа B на круизном судне у побережья Сан-Паулу, Бразилия

.

J Travel Med

2014

;

21

:

298

303

.84

Browne

A

Ahmad

SS

Beck

CR

et al..

Роль транспортных узлов в распространении гриппа и коронавирусов: систематический обзор

.

J Travel Med

2016

;

23

: tav002.

85

Marshall

CA

Morris

E

Unwin

N.

Эпидемиологическое исследование показателей заболеваемости пассажиров и членов экипажа в загруженном карибском круизном порту

.

BMC Public Health

2016

;

16

:

314.

86

Грипп у путешественников на Аляску, территорию Юкон и на круизных лайнерах западного побережья, лето 1999 г.

.

Can Commun Dis Rep

1999

;

25

:

137

9

.87

Ferson

M

Paraskevopoulos

P

Hatzi

S

et al. .

Предположительный летний грипп A: вспышка во время круиза через Тасман

.

Commun Dis Intell

2000

;

24

:

45

7

.88

Ward

KA

Armstrong

P

McAnulty

JM

et al. .

Вспышки пандемии (h2N1) 2009 г. и сезонного гриппа A (h4N2) на круизном судне

.

Emerg Infect Dis

2010

;

16

:

1731

7

.89

Brotherton

JM

Delpech

VC

Gilbert

GL

et al. .

Крупная вспышка гриппа A и B на круизном лайнере, вызвавшая массовую заболеваемость

.

Epidemiol Infect

2003

;

130

:

263

71

.90

Mouchtouri

V

Черный

N

Nichols

G

et al. .

Готовность к профилактике и борьбе со вспышками гриппа на пассажирских судах в ЕС: сообщение проекта SHIPSAN TRAINET

.

Euro Surveill

2009

;

14

: 1

4

.91

Claas

EC

Osterhaus

AD

фургон

BR

и др..

Человеческий грипп Вирус H5N1, относящийся к высокопатогенному вирусу птичьего гриппа

.

Ланцет

1998

;

351

:

472

7

.92

Claas

EC

Osterhaus

AD.

Новые ключи к разгадке пандемии гриппа

.

Nat Med

1998

;

4

:

1122

3

,93

Суббарао

K

Климов

A

Katz

J

et al..

Характеристика вируса птичьего гриппа A (H5N1), выделенного от ребенка со смертельным респираторным заболеванием

.

Science

1998

;

279

:

393

6

.94

Раджабали

N

Lim

T

Sokolowski

C

et al. .

Инфекция птичьего гриппа A (H5N1) с дыхательной недостаточностью и менингоэнцефалитом у канадского путешественника

.

Может ли заразить Dis Med Microbiol

2015

;

26

:

221

3

.95

To

KK

Ng

KH

Que

TL

et al. .

Птичий грипп Вирус H5N1: постоянная угроза для человека

.

Emerg Microbes Infect

2012

;

1

:

e25.

96

Leggat

PA

Mills

D

Speare

R.

Знания хостелистов о передаче и профилактике птичьего гриппа во время зарубежных поездок

.

Travel Med Infect Dis

2007

;

5

:

53

6

.97

Di

GG

Abbate

R

Albano

L

et al. .

Обзор знаний, отношения и практики в отношении птичьего гриппа среди взрослого населения Италии

.

BMC Infect Dis

2008

;

8

:

36.

98

Houser

K

Subbarao

K.

Вакцины против гриппа: проблемы и решения

.

Cell Host Microbe

2015

;

17

:

295

300

.99

Беднарчик

RA

Chu

SL

Sickler

H

et al. .

Низкое потребление вакцины против гриппа среди студентов университетов: оценка предикторов, выходящих за рамки соображений стоимости и безопасности

.

Вакцина

2015

;

33

:

1659

63

.100

Хан

NM

Jentes

ES

Коричневый

C

et al. .

Медицинская подготовка к поездке деловых людей и профессиональных путешественников: анализ Глобального консорциума TravEpiNet, 2009-2012 гг.

.

J Occup Environ Med

2016

;

58

:

76

82

.101

Pfeil

A

Mutsch

M

Hatz

C

et al..

Поперечное исследование для оценки знаний, отношения и практики (KAP) в отношении вакцинации против сезонного гриппа среди европейских путешественников в места с ограниченными ресурсами

.

BMC Public Health

2010

;

10

:

402

.

© Международное общество медицины путешествий, 2016. Опубликовано Oxford University Press.

Это статья в открытом доступе, распространяемая в соответствии с условиями некоммерческой лицензии Creative Commons Attribution (http: // creativecommons.org / licenses / by-nc / 4.0 /), который разрешает некоммерческое повторное использование, распространение и воспроизведение на любом носителе при условии правильного цитирования оригинальной работы. По вопросам коммерческого повторного использования обращайтесь по адресу [email protected]

Оптимизация стратегий профилактики и лечения

US Pharm. 2014; 39 (7): 19-26.

РЕФЕРАТ: Сезонный грипп является важной причиной заболеваемости и смертности во всем мире. Профилактика инфекции является ключевым моментом, и вакцинация против гриппа рекомендуется всем людям в возрасте от 6 месяцев и старше.При своевременном и правильном использовании противовирусные средства могут помочь уменьшить бремя болезней. Фармацевты играют решающую роль в оптимизации профилактики, пропагандируя и проводя вакцинацию против гриппа, а также рекомендуя противовирусную терапию при наличии показаний.

Сезонный грипп вызывает серьезные респираторные заболевания, в результате чего ежегодно в США умирает около 25 000 человек. Грипп характеризуется высокой температурой, которая часто возникает внезапно, миалгией, болью в горле, головной болью и непродуктивным кашлем. 1 Хотя симптомы обычно проходят самостоятельно и проходят в течение нескольких дней, осложнения, включая вторичные бактериальные инфекции, такие как пневмония, могут быть серьезными. В этой статье будет обсуждаться использование стратегий вакцинации для профилактики и противовирусных препаратов для лечения.

История

Знание естественной истории гриппа важно для понимания постоянного значения вакцины против гриппа. Грипп — это РНК-вирус с тремя типами антигенов: A, B и C.Большинство клинических заболеваний вызывается типами A и B. Грипп A также связан с подтипами, основанными на двух поверхностных антигенах: гемагглютинин, отвечающий за прикрепление вируса к клеткам, и нейраминидаза, отвечающая за проникновение вируса в клетки. Генетическое изменение этих поверхностных антигенов с течением времени приводит к антигенным сдвигам и дрейфу, которые при передаче от человека к человеку могут привести к пандемии или эпидемии, соответственно. Эпидемии и пандемии гриппа, приведшие к миллионам смертей и вызвавшие широкое распространение респираторных заболеваний, были задокументированы еще в 1500-х годах.Последней крупной пандемией, отмеченной в США, был новый вирус гриппа A (h2N1) в 2009 году. 2

Грипп обычно наиболее распространен в осенние и зимние месяцы. 2 CDC публикует еженедельные данные эпиднадзора, указывающие на распространенность гриппа в США, а также дополнительную информацию о связанных с гриппом смертях, госпитализациях, антигенной характеристике и характеристиках устойчивости к противовирусным препаратам. 3

Вакцина против гриппа

Иммунизация против гриппа имеет первостепенное значение для снижения бремени болезней.В настоящее время в США доступны три типа противогриппозной вакцины, в том числе трехвалентная и четырехвалентные инактивированные вакцины против гриппа (IIV) и живая аттенуированная вакцина против гриппа (LAIV) ( ТАБЛИЦА 1 ).


Трехвалентная инактивированная вакцина против гриппа (TIV) впервые стала доступна в 1940-х годах. 1 Вакцина содержит три инактивированных вируса (два типа A и один тип B), один или несколько штаммов которых заменяются каждый год для обеспечения защиты на основе эпиднадзора за гриппом и ожидаемой активности. 2 Несколько производителей фармацевтической продукции несут ответственность за разработку и подготовку TIV. Инактивированный вирус исторически выращивали в куриных яйцах; однако новая рекомбинантная технология позволила разработать вакцину (RIV), не содержащую яиц, — вариант для людей с анафилаксией по отношению к яичным белкам. В 2013 году новый В США впервые была продана четырехвалентная вакцина, которая обеспечивает более широкую защиту, покрывая дополнительный штамм вируса гриппа B. 2,4

Доступны новые препараты IIV, в том числе препараты с высокими дозами для лиц пожилого возраста. > 65 лет и внутрикожная вакцина.В настоящее время Консультативный комитет по практике иммунизации не указал предпочтения этим агентам. 1 Иммунизаторы должны соблюдать рекомендации по дозировке и администрации, а также возрастные ограничения для отдельных вакцин.

Дозировка IIV для взрослых составляет 0,5 мл внутримышечно один раз в год во время сезона гриппа; Детская доза составляет 0,25 мл внутримышечно для детей в возрасте от 6 до 35 месяцев. При первом введении вакцины против гриппа дети в возрасте от 6 месяцев до 8 лет должны получить вторую дозу через 1 месяц после введения первой, чтобы вызвать соответствующий иммунный ответ. 1,2

У здоровых людей в возрасте <65 лет TIV примерно на 90% эффективен в профилактике заболеваний. 1,2 Хотя эффективность значительно снижается с возрастом, пациенты в возрасте> 65 лет по-прежнему получают пользу за счет предотвращения госпитализаций и смерти.

Еще один вариант иммунизации здоровых, небеременные люди в возрасте от 2 до 49 лет — это LAIV. LAIV вводится в виде однократного назального спрея, при этом половина дозы вводится в каждую ноздрю.Для эффективности вакцины требуется репликация вируса на слизистую носоглотки. Исследования на детях показали более высокую эффективность LAIV по сравнению с TIV, но доказательства, подтверждающие повышение эффективности у взрослых, ограничены. 1,2 Четырехвалентный LAIV доступен в США и заменил трехвалентный препарат в сезоне 2013–2014 гг.

Противопоказаний к вакцине против гриппа немного. Пациенты, у которых в анамнезе была тяжелая аллергическая реакция на яичный белок, другие компоненты вакцины или предыдущая доза какой-либо вакцины против гриппа, не должны получать IIV или LAIV.Помимо возрастных ограничений, другие противопоказания для LAIV включают астму или другие хронические легочные заболевания; сердечно-сосудистые, почечные, печеночные, неврологические / нервно-мышечные, гематологические или метаболические нарушения; иммуносупрессия; и беременность. Следует проявлять осторожность при введении вакцины против гриппа пациентам со средним или тяжелым заболеванием с лихорадкой или без нее. У пациентов с анамнезом Синдром Гийена-Барре в течение 6 недель после введения предыдущей дозы вакцины против гриппа, следует соблюдать осторожность при введении последующих доз. 2

Продолжаются исследования новых технологий для повышения эффективности и доставки вакцин. Другая технология, не основанная на яйцах, с использованием клеточных культур и рекомбинантной ДНК, находится в стадии разработки. Адъювантная вакцина для усиления иммунного ответа в настоящее время исследуется. 4 Исследования с использованием новых систем доставки, включая самовакцинацию с использованием патчи с микроиглами, обещают приемлемость и удобство использования. 5

Противовирусные препараты

Хотя вакцинация является предпочтительным методом профилактики заболеваний, вызываемых вирусом гриппа, противовирусные препараты могут играть дополнительную роль в профилактике.Противовирусные препараты также используются для лечения как неосложненных, так и сложных заболеваний. 6 В настоящее время два класса противовирусных препаратов одобрены FDA для профилактики и лечения гриппа: адамантаны и ингибиторы нейраминидазы. В адамантаны включают амантадин и римантадин. Хотя механизм действия полностью не выяснен, адамантаны преимущественно блокируют снятие оболочки вирусной РНК внутри инфицированных клеток-хозяев и предотвращение ее репликации путем вмешательства в функцию трансмембранный домен вирусного белка М2. 7 Ингибиторы нейраминидазы включают осельтамивир (Тамифлю) и занамивир ( Relenza), а противовирусный механизм действия заключается в ингибировании нейраминидазы вируса гриппа, влияющей на распространение вируса в дыхательных путях. 8,9

Противовирусная устойчивость

Хотя оба класса противовирусных препаратов имеют показания для профилактики и лечения гриппа, адамантаны обладают высоким (> 99%) уровнем устойчивости к гриппу A (h2N1) и A (h4N2) и не активны против гриппа B. 6 Соответственно, CDC заявляет, что эти агенты считаются устойчивыми к циркулирующим в настоящее время вирусам в сезоне 2013–2014 годов, и не рекомендует их использование для лечения и профилактики. 6 На основании текущих данных об устойчивости предполагается, что то же самое будет и в сезоне гриппа 2014–2015 гг. Следовательно Адамантаны в этой статье обсуждаться не будут.

По данным эпиднадзора CDC, в конце сезона гриппа 2013–2014 гг. Ингибиторы нейраминидазы осельтамивир и Сообщается, что уровень устойчивости к занамивиру составляет 1.2% и 0% соответственно. 3 Ежегодный обзор данных эпиднадзора в течение сезона гриппа является обязательным, поскольку характер и уровни устойчивости постоянно меняются. Эта информация должна использоваться для принятия решений о предпочтительных средствах для профилактики и лечения.

Ингибиторы нейраминидазы

Эти агенты ( ТАБЛИЦА 2 ) активны против вирусов гриппа A и B. 6 Лечение с помощью Осельтамивир снижает продолжительность симптомов болезни на 1 или 2 дня, если его начать в течение 36 часов и 24 часов, соответственно. 10,11 Лечение осельтамивиром также снижает смертность. 12


Осельтамивир доступен в виде пероральных капсул и суспензии. 8 В 2012 году FDA изменило показания и использование этого агента, включив в него лечение пациентов в возрасте > 2 недели. 8 Однако использование орального Осельтамивир для младенцев в возрасте <14 дней рекомендован CDC и Американской академией педиатрии. 6,13 Занамивир выпускается в виде порошка для пероральной ингаляции; он не рекомендуется для людей с респираторными заболеваниями, включая астму и хроническую обструктивную болезнь легких, а также противопоказан людям с аллергией на молочные белки. 6,9 Лечение оральным Занамивир можно назначать пациентам в возрасте от 7 лет и не рекомендуется при тяжелых, осложненных заболеваниях. 6,9 В случае устойчивый к осельтамивиру вирус у тяжелобольного госпитализированного пациента, внутривенно Занамивир доступен для сострадательного использования через экстренный запрос на новый исследуемый препарат у производителя или участие в продолжающемся клиническом исследовании III фазы. 14 В исследовании, посвященном будущей устойчивости, эффективность комбинированного лечения с осельтамивир и занамивир сравнивали с каждым монотерапия и Комбинированная терапия оказалась менее эффективной. 15

Лечение

Наибольший клинический эффект от ингибиторов нейраминидазы проявляется при раннем начале, особенно в течение 48 часов после начала заболевания гриппом. Лечение должно начинаться как можно скорее у пациентов с подтвержденным или подозреваемым гриппом, которые госпитализированы, имеют тяжелое или осложненное заболевание или находятся в группе высокого риска осложнений гриппа; в этих случаях лица, назначающие препараты, не должны ждать лабораторного подтверждения вируса, прежде чем начать лечение. 6,16 В ТАБЛИЦА 3 . В нескольких обсервационных исследованиях и совсем недавно в рандомизированном контролируемом исследовании: Было обнаружено, что осельтамивир сокращает продолжительность болезни и выделение вируса, когда противовирусное средство было получено после 48-часового окна, но в течение 5 дней с момента начала заболевания. 17


Ингибиторы нейраминидазы были связаны со снижением смертности у госпитализированных пациентов по сравнению с отсутствием лечения.Мета-анализ, сравнивающий ингибиторы нейраминидазы, введенные в течение 2 дней после появления симптомов без лечения, выявил связанное с этим снижение риска смертности (отношение шансов 0,81, 95% ДИ 0,7-0,93; P = 0,0024). 12 Коэффициент риска смертности, который увеличивался с каждым днем ​​задержки начала лечения, по-прежнему оказался статистически значимым. 12 Таким образом, рекомендуется начинать лечение ингибиторами нейраминидазы как можно раньше при любом подозреваемом или подтвержденном гриппе.

Дозировка и продолжительность

Дозирование ингибиторов нейраминидазы при осельтамивир и занамивир для всех возрастных групп резюмируется в ТАБЛИЦА 4 . Осельтамивир требует корректировки дозы примерно на клиренс креатинина <30 мл / мин. 8 Коррекция дозы не рекомендуется пациентам с ожирением. Когортное исследование обнаружило слабую корреляцию между ИМТ. > 40 кг / м 2 и выведение препарата. 18 Двойная доза терапии была описана в литературе для госпитализированных пациентов.Проспективное интервенционное исследование не выявило клинически значимой разницы в результатах между дозировкой 75 и 150 мг два раза в день у госпитализированных пациентов с тяжелой инфекцией гриппа А. 19 В двойном слепом рандомизированном контролируемом исследовании изучалась эффективность двойной дозы осельтамивира и обнаружили отсутствие дополнительных преимуществ двойного приема у взрослых и детей в условиях стационара. 20


Рекомендуемая FDA продолжительность лечения ингибиторами нейраминидазы составляет 5 дней. 8,9 Некоторые эксперты рекомендуют более длительный срок для тяжелобольных госпитализированных пациентов. Клиническая оценка должна определять решение о продолжении терапии сверх стандартных 5 дней у тяжелобольных госпитализированных пациентов.

Вывод

Заболевание гриппом связано с заболеваемостью и смертностью, и вакцинация является краеугольным камнем профилактики инфекций. Фармацевты имеют первостепенное значение в защите пациентов посредством образования и пропаганда ежегодной иммунизации.Тщательный надзор за прогнозируемыми штаммами вирусов и уровнем резистентности к доступным противовирусным препаратам на каждый сезон позволяет фармацевтам рекомендовать соответствующие вакцины и надлежащий выбор противовирусных препаратов, когда это необходимо.

ССЫЛКИ

1. Грипп. В: CDC. Эпидемиология и профилактика заболеваний, предупреждаемых с помощью вакцин . 12-е изд. Вашингтон, округ Колумбия: Фонд общественного здравоохранения; 2012 г.
2. CDC. Профилактика и борьба с сезонным гриппом с помощью вакцин.Рекомендации Консультативного комитета по практике иммунизации — США, 2013-2014 гг. MMWR Рекомендуем Rep . 2013; 62: 1-43.
3. CDC. FluView. www.cdc.gov/flu/weekly. Доступ 25 апреля 2014 г.
4. Нафцигер А.Н., Пратт Д.С. Вакцинация от сезонного гриппа и технологии. Дж Clin Pharmacol. 2014; 54: 719-731
5. Норман Дж. Дж., Арья Дж. М., Макклейн М. А. и др. Пластыри с микроиглами: пригодность и приемлемость для самовакцинации против гриппа. Вакцина . 2014; 32: 1856-1862.
6. CDC. Противовирусные препараты от гриппа: краткое содержание для клиницистов. www.cdc.gov/flu/professionals/antivirals/summary-clinICAL.htm. По состоянию на 29 марта 2014 г.
7. Кацунг Б.Г., Мастерс С.Б., Тревор А.Дж. Базовая и клиническая фармакология . 12-е изд. Нью-Йорк, штат Нью-Йорк: Макгроу Хилл; 2012: 886-887.
8. Тамифлю ( осельтамивир) информацию о продукте. Южный Сан-Франциско, Калифорния: Genentech, Inc; Января 2013.
9.Реленца ( занамивир) информация о продукте. Парк Исследовательского Треугольника, Северная Каролина: GlaxoSmithKline; Декабрь 2011 г.
10. Николсон К.Г., Аоки FY, Osterhaus AD, et al. Эффективность и безопасность осельтамивир в лечении острого гриппа: a рандомизированное контролируемое исследование. Группа исследователей лечения гриппа с ингибиторами нейраминидазы. Ланцет . 2000; 355: 1845-1850.
11. Треанор Дж. Дж., Хайден Ф. Г., Vrooman PS, et al. Эффективность и безопасность перорального ингибитора нейраминидазы осельтамивир в лечении острого гриппа: рандомизированное контролируемое исследование.Группа по изучению пероральной нейраминидазы США. JAMA . 2000; 283: 1016-1624.
12. Мутхури С.Г., Венкатесан С., Майлс П.Р. и др. Эффективность ингибиторов нейраминидазы в снижении смертности у пациентов, госпитализированных с инфекцией вируса гриппа A h2N1pdm09: метаанализ данных отдельных участников. Ланцет Респир Мед . 2014; 2: 395-404.
13. Комитет по инфекционным заболеваниям Американской академии педиатрии. Рекомендации по профилактике гриппа у детей и борьбе с ним, 2013–2014 гг. Педиатрия . 2013; 132: e1089-e1104.
14. CDC. Внутривенные противовирусные препараты от гриппа и рекомендации CDC, связанные с исследовательским использованием внутривенных препаратов. занамивир для сезона гриппа 2013-2014 гг. www.cdc.gov/flu/professionals/antivirals/intravenous-antivirals.htm. По состоянию на 29 апреля 2014 г.
15. Duval X, van der Верф С, Бланшон Т. и др. Эффективность комбинация осельтамивир-занамивир по сравнению с каждым из них монотерапия сезонного гриппа: рандомизированное плацебо-контролируемое исследование. PLoS Med . 2010; 7: e1000362.
16. Виас Д, Паньо-Пардо-младший, Пачон Дж. И др. Сроки Применение осельтамивира и исходы у госпитализированных взрослых с пандемической инфекцией, вызванной вирусом гриппа A (h2N1) 2009 года. Сундук . 2011; 140: 1025-1032.
17. Фрай А.М., Госвами Д., Нахар К. и др. Эффективность Лечение осельтамивиром было начато в течение 5 дней с момента появления симптомов для сокращения продолжительности заболевания гриппом и распространения вируса в городских условиях в Бангладеш: рандомизированное плацебо-контролируемое исследование. Lancet Infect Dis. 2014; 14: 109-118.
18. Пай депутат, Лодис Т.П. мл. Осельтамивир и Фармакокинетика осельтамивира карбоксилата у взрослых с ожирением: изменение дозы в зависимости от веса не требуется. Противомикробные препараты Агенты Chemother . 2011; 55: 5640-5645.
19. Ли Н, Хуэй Д.С., Zuo Z, et al. Проспективное интервенционное исследование более высоких доз лечение осельтамивиром взрослых, госпитализированных с инфекциями гриппа A и B. Clin Infect Dis . 2013; 57: 1511-1519.
20. Сеть клинических исследований инфекционных болезней Юго-Восточной Азии. Эффект двойной дозы осельтамивир по клиническим и вирусологические исходы у детей и взрослых, госпитализированных с тяжелым гриппом: двойной слепой рандомизированное контролируемое исследование. BMJ. 2013; 346: f3039.

Чтобы прокомментировать эту статью, свяжитесь с [email protected]

Грипп: диагностика и лечение — Американский семейный врач

1.Таубенбергер Дж. К., Morens DM. Грипп: пандемия однажды и в будущем. Представитель общественного здравоохранения . 2010; 125 (приложение 3): 16–26 ….

2. Barberis I, Майлз П, Олт СК, и другие. История и эволюция борьбы с гриппом с помощью вакцинации: от первой моновалентной вакцины до универсальных вакцин. J Пред. Med Hyg . 2016; 57 (3): E115 – E120.

3. Иулиано А. Д., Рогуски КМ, Чанг ХХ, и другие.; Глобальная сеть сотрудников по вопросам смертности, связанной с сезонным гриппом. Оценки глобальной респираторной смертности, связанной с сезонным гриппом: модельное исследование [опубликованная поправка опубликована в Lancet. 2018; 391 (10127): 1262]. Ланцет . 2018; 391 (10127): 1285–1300.

4. Центры по контролю и профилактике заболеваний. Грипп (грипп): бремя гриппа. Обновлено 19 февраля 2019 г. Проверено 5 октября 2019 г. https://www.cdc.gov/flu/about/burden/index.html

5.Garten R, Blanton L, Элал АИА, и другие. Обновленная информация: активность гриппа в США в сезоне 2017–18 гг. И состав вакцины против гриппа 2018–1919 гг. MMWR Morb Mortal Wkly Rep . 2018. 67 (22): 634–642.

6. Сюй Х, Blanton L, Абд Элал А.И., и другие. Обновленная информация: активность гриппа в США в сезоне 2018–2019 годов и состав вакцины против гриппа 2019–2020 годов. MMWR Morb Mortal Wkly Rep .2019; 68 (24): 544–551. По состоянию на 7 октября 2019 г. https://www.cdc.gov/mmwr/volumes/68/wr/mm6824a3.htm.

7. Moser MR, Бендер Т.Р., Марголис Х.С., и другие. Вспышка гриппа на борту коммерческого авиалайнера. Am J Epidemiol . 1979; 110 (1): 1–6.

8. Центры по контролю и профилактике заболеваний. Грипп (грипп): клинические признаки и симптомы гриппа. Обновлено 8 марта 2019 г. Проверено 5 октября 2019 г. https: //www.cdc.правительство / грипп / профессионалы / acip / clinic.htm

9. Leekha S, Zitterkopf NL, Эспи MJ, и другие. Продолжительность распространения вируса гриппа А у госпитализированных пациентов и последствия для инфекционного контроля. Инфекционный контроль Hosp Epidemiol . 2007. 28 (9): 1071–1076.

10. Бальдо В., Бертончелло С, Cocchio S, и другие. Новый вирус пандемического гриппа A / (h2N1) pdm09: действительно ли он «новый»? J Пред. Med Hyg .2016; 57 (1): E19 – E22.

11. Дауд Ф.С., Юлиано А.Д., Рид C, и другие. Расчетная глобальная смертность, связанная с первыми 12 месяцами пандемического гриппа 2009 г. Циркуляция вируса h2N1: модельное исследование. Ланцет Infect Dis . 2012. 12 (9): 687–695.

12. Гринбаум А, Куинн С, Бейлер J, и другие. Расследование вспышки инфекции вируса вариантного гриппа A (h4N2), связанной с сельскохозяйственной ярмаркой — Огайо, август 2012 г. J Заразить Dis . 2015; 212 (10): 1592–1599.

13. Duwell MM, Блайт Д, Радебо MW, и другие. Вспышка вируса варианта гриппа A (h4N2) на трех выставках — Мэриленд, 2017 г. MMWR Morb Mortal Wkly Rep . 2018. 67 (42): 1169–1173.

14. Харфут Р, Уэбби Р.Дж. Грипп H5, глобальное обновление. Дж Микробиол . 2017; 55 (3): 196–203.

15. Гроскопф Л.А., Алянак Е, Бродер К.Р., и другие.Профилактика сезонного гриппа и борьба с ним с помощью вакцин: рекомендации Консультативного комитета по практике иммунизации — США, сезон гриппа 2019–2020 гг. MMWR Recomm Rep . 2019; 68 (RR-3): 1–21.

16. Американская академия семейных врачей. Профилактика и борьба с сезонным гриппом с помощью вакцин. По состоянию на 7 мая 2019 г. https://www.aafp.org/patient-care/public-health/immunizations/influenza.html

17. Эрлих И.В., Авраам С, Кондамуди ВК.Управление гриппом. Am Fam Врач . 2010. 82 (9): 1087–1095. По состоянию на 5 сентября 2019 г. https://www.aafp.org/afp/2010/1101/p1087.html

18. Центры по контролю и профилактике заболеваний. Грипп (грипп): для врачей: противовирусные препараты. Обновлено 27 декабря 2018 г. По состоянию на 24 февраля 2019 г. https://www.cdc.gov/flu/professionals/antivirals/summary-clinICAL.htm

19. Центры по контролю и профилактике заболеваний. Грипп (грипп): руководство по тестированию на грипп.Обновлено 4 марта 2019 г. По состоянию на 5 октября 2019 г. https://www.cdc.gov/flu/professionals/diagnosis/consider-influenza-testing.htm

20. Stoeckle J, Каннингем А, Диас V, и другие. Назад к основам: пять шагов к повышению показателей вакцинации против гриппа. Фам Прак Манаг . 2017; 24 (6): 30–33. По состоянию на 5 сентября 2019 г. https://www.aafp.org/fpm/2017/1100/p30.html

21. Fogarty CT, Круз Л. Как говорить о прививке от гриппа неохотным пациентам. Фам Прак Манаг . 2017; 24 (5): 6–8. По состоянию на 5 сентября 2019 г. https://www.aafp.org/fpm/2017/0900/p6.html

22. Центры по контролю и профилактике заболеваний. Грипп (грипп): иммуногенность, эффективность и действенность противогриппозных вакцин. Обновлено 23 августа 2018 г. По состоянию на 22 января 2019 г. https://www.cdc.gov/flu/professionals/acip/2018-2019/background/immunogenicity.htm

23. DiazGranados CA, Даннинг Эй Джей, Киммел М, и другие.Эффективность вакцины против гриппа в высоких дозах по сравнению со стандартной дозой у пожилых людей. N Engl J Med . 2014. 371 (7): 635–645.

24. DiazGranados CA, Робертсон, Калифорния, Talbot HK, и другие. Профилактика серьезных событий у взрослых в возрасте 65 лет и старше: сравнение высоких и стандартных доз инактивированных вакцин против гриппа. Вакцина . 2015; 33 (38): 4988–4993.

25. Петерандерл С., Герольд С, Шмольдт К.Инфекции вируса гриппа человека. Semin Respir Crit Care Med . 2016; 37 (4): 487–500.

26. Продавцы SA, Каган Р.С., Хайден Ф.Г., и другие. Скрытое бремя гриппа: обзор внелегочных осложнений гриппозной инфекции. Другие респирные вирусы гриппа . 2017; 11 (5): 372–393.

27. фон Ранке FM, Занетти Дж., Хохеггер Б, и другие. Инфекционные заболевания, вызывающие диффузное альвеолярное кровотечение у иммунокомпетентных пациентов: современный обзор. Легкое . 2013. 191 (1): 9–18.

28. Uyeki TM, Бернштейн HH, Брэдли Дж. С., и другие. Руководство по клинической практике Американского общества инфекционистов: обновленная информация о диагностике, лечении, химиопрофилактике и институциональном управлении вспышками сезонного гриппа за 2018 г. Clin Infect Dis . 2019; 68 (6): 895–902.

29. Эбелл М.Х., Афонсу А.М., Гонсалес Р, и другие. Разработка и проверка правила клинического решения для диагностики гриппа. J Am Board Fam Med . 2012. 25 (1): 55–62.

30. Дейл А.П., Эбелл М, Маккей Б, и другие. Влияние экспресс-теста на грипп в местах оказания медицинской помощи на согласованный уход и использование антибиотиков. J Am Board Fam Med . 2019; 32 (2): 226–233.

31. Merckx J, Вали Р, Шиллер I, и другие. Диагностическая точность новых и традиционных экспресс-тестов на грипп по сравнению с полимеразной цепной реакцией с обратной транскриптазой: систематический обзор и метаанализ. Энн Интерн Мед. . 2017; 167 (6): 394–409.

32. Мутхури С.Г., Майлз PR, Венкатесан С, и другие. Влияние лечения ингибиторами нейраминидазы на результаты, важные для общественного здравоохранения во время пандемии гриппа A (h2N1) 2009–2010 гг .: систематический обзор и метаанализ у госпитализированных пациентов. J Заразить Dis . 2013. 207 (4): 553–563.

33. Джефферсон Т., Джонс Массачусетс, Доши П., и другие.Ингибиторы нейраминидазы для профилактики и лечения гриппа у здоровых взрослых и детей. Кокрановская база данных Syst Rev . 2014; (4): CD008965.

34. Мутхури С.Г., Венкатесан С, Майлз PR, и другие.; Исследователи Консорциума ПРАЙД. Эффективность ингибиторов нейраминидазы в снижении смертности у пациентов, госпитализированных с инфекцией вируса гриппа A h2N1pdm09: метаанализ данных отдельных участников. Ланцет Респир Мед . 2014. 2 (5): 395–404.

35. Луи Дж. К., Ян С, Самуэль MC, и другие. Ингибиторы нейраминидазы для больных гриппом в критическом состоянии. Педиатрия . 2013; 132 (6): e1539 – e1545.

36. Ли Н, Лев Ю.С., Цао Б, и другие. Ингибиторы нейраминидазы, суперинфекция и кортикостероиды влияют на выживаемость больных гриппом. Eur Respir J .2015; 45 (6): 1642–1652.

37. Хео Я. Балоксавир: первое глобальное одобрение. Наркотики . 2018; 78 (6): 693–697.

38. Хайден Ф.Г., Сугая Н, Хироцу Н, и другие.; Группа исследователей балоксавира марбоксила. Балоксавир марбоксил при неосложненном гриппе у взрослых и подростков. N Engl J Med . 2018; 379 (10): 913–923.

39. Джефферсон Т., Джонс М, Доши П., и другие.Осельтамивир от гриппа у взрослых и детей: систематический обзор отчетов о клинических исследованиях и резюме комментариев регулирующих органов. BMJ . 2014; 348: g2545.

40. Центры по контролю и профилактике заболеваний. Временное руководство по ведению вспышек гриппа в учреждениях длительного ухода и пост-неотложной помощи. Проверено 12 февраля 2019 г. Проверено 5 октября 2019 г. https://www.cdc.gov/flu/professionals/infectioncontrol/ltc-facility-guidance.htm

41. Montalto NJ.Офисный подход к гриппу: клиническая диагностика и лабораторные исследования. Am Fam Врач . 2003. 67 (1): 111–118. По состоянию на 5 сентября 2019 г. https://www.aafp.org/afp/2003/0101/p111.html

42. Montalto NJ, Камедь КД, Эшли СП. Обновленное лечение гриппа A и B. Am Fam Physician . 2000. 62 (11): 2467–2476. По состоянию на 5 сентября 2019 г. https://www.aafp.org/afp/2000/1201/p2467.html

Надзор за госпитализацией за гриппом — Программа новых инфекций — Центр общественного здоровья и профилактики

Назначение

Активное наблюдение за госпитализированными лабораторно подтвержденными случаями гриппа среди жителей семи округов Рочестер, обслуживаемого районом, началось в 2004 году в рамках Программы Центров по контролю и профилактике новых инфекций (EIP) Flu-Surv.сеть. О лабораторно подтвержденном гриппе сообщается в Департамент общественного здравоохранения штата Нью-Йорк. Персонал EIP собирает данные для определения основных состояний, моделей тестирования на грипп и маркеров тяжести заболевания.

Цели и задачи

  • Определите возрастную частоту лабораторно подтвержденных госпитализаций, связанных с гриппом.
  • Определите частоту серьезных осложнений, связанных с гриппом, таких как вторичные бактериальные инфекции, и необходимость госпитализации в отделение интенсивной терапии / искусственной вентиляции легких.
  • Определите факторы, связанные с тяжелым заболеванием или осложнениями, связанными с гриппом.
  • Оценить соблюдение рекомендаций по вакцинации против гриппа.

Деятельность

Активное наблюдение за лабораторно подтвержденными госпитализациями по поводу гриппа проводится среди жителей семи округов Рочестер, обслуживаемых территорией. Случай определяется как житель зоны обслуживания, поступивший в больницу с лабораторно подтвержденной инфекцией гриппа.Данные FluSurv-Net используются для создания национальных оценок общего числа случаев гриппа, посещений врача и госпитализаций.

В настоящее время проводится комплексный и совокупный анализ данных по этому проекту, и он доступен на следующих веб-сайтах:

Данные

Частота госпитализаций против гриппа варьируется в зависимости от сезона и возрастной группы и зависит от циркулирующих штаммов гриппа и эффективности вакцины против гриппа.

Для получения информации о случаях гриппа с разбивкой по возрасту за 2017–2018 годы посетите RocHealthData.орг.

Избранные публикации

  • Cummings CN, O’Halloran AC, Azenkot T, Reingold A, Alden NB, Meek JI, Anderson EJ, Ryan PA, Kim S, McMahon M, McMullen C, Spina NL, Bennett NM , Billing LM, Thomas A, Schaffner W, Talbot HK, George A, Reed C, Garg S. Грипп, приобретенный в больнице в Соединенных Штатах, FluSurv-NET, с 2011-2012 по 2018-2019 гг. Infect Control Hosp Epidemiol. 2021 окт 5: 1-7. DOI: 10.1017 / ice.2021.392. Epub впереди печати. PMID: 34607624.

  • O’Halloran AC, Holstein R, Cummings C, Bennett NM , et al. Показатели госпитализаций, связанных с гриппом, госпитализаций в отделения интенсивной терапии и случаев смерти в больницах по признаку расы и этнической принадлежности в США с 2009 по 2019 год. JAMA Netw Open. 2021; 4 (8): e2121880. DOI: 10.1001 / jamanetworkopen.2021.21880

  • Чоу EJ, Рольфес MA, О’Халлоран A, Андерсон EJ, Bennett NM , Billing L, Chai S, Dufort E, Herlihy R, Kim S, Lynfield R, McMullen C, Monroe ML, Schaffner W, Spencer M, Талбот Х.К., Томас А., Юси-Хиндес К., Рид С., Гарг С.; Острые сердечно-сосудистые события, связанные с гриппом у госпитализированных взрослых: перекрестное исследование. Энн Интерн Мед. . 25 августа 2020 г. Онлайн до печати. DOI: 10.7326 / M20-1509. PMID: 32833488.

  • Sloan C, Chandrasekhar R, Mitchel E, Ndi D, Miller L, Thomas A, Bennett NM , Chai S, Spencer M, Eckel S, Spina N, Monroe M, Anderson EJ, Lynfield R и др. Пространственная и временная кластеризация пациентов, госпитализированных с лабораторно подтвержденным гриппом в США.Эпидемии. 2020 июнь; 31, doi.org/10.1016/j.epidem.2020.100387.
  • Чоу Э.Дж., Рольфес М.А., О’Халлоран А., Олден Н.Б., Андерсон Э.Дж., Беннетт Н.М. , Биллинг Л., Дюфорт Э, Кирли П.Д., Джордж А., Иризарри Л., Ким С., Линфилд Р., Райан П., Шаффнер В., Talbot HK, Thomas A, Yousey-Hindes K, Reed C, Garg S. Респираторные и недыхательные диагнозы, связанные с гриппом у госпитализированных взрослых. JAMA Netw Open. 2020 марта 2; 3 (3): e201323. DOI: 10.1001 / jamanetworkopen.2020.1323. PMID: 321

    [PubMed — в процессе]

  • Czaja CA, Miller L, Alden N, Wald HL, Cummings CN, Rolfes MA, Anderson EJ, Bennett NM , Billing LM, Chai SJ, Eckel S, Mansmann R, McMahon M, Monroe ML, Muse A, Risk I , Шаффнер В., Томас А.Р., Юси-Хиндес К., Гарг С., Херлихи Р.К.Возрастные различия в частоте госпитализаций, клинической картине и результатах среди пожилых людей, госпитализированных с гриппом — США. Сеть наблюдения за госпитализацией гриппа (FluSurv-NET). Открытый форум Infect Dis. 2019 Июл 1; 6 (7). DOI: 10.1093 / ofid / ofz225
  • Rolfes MA, Flannery B, Chung J, O’Halloran A, Garg S, Belongia EA, Gaglani M, Zimmerman R, Jackson ML, Monto AS, Alden NB, Anderson E, Bennett NM et al. Влияние вакцинации против гриппа в США в сезон гриппа 2017-2018 гг.Клинические инфекционные болезни. 2019 Февраль, https://doi.org/10.1093/cid/ciz075
  • Коллинз Дж. П., Кэмпбелл А. П., Опено К., Фарли М. М., Каммингс С. Н., Кирли П. Д., Херлихи Р., Юси-Хиндес К., Монро М. Л., Ладиски М., Линфилд Р., Баумбах Дж., Спина Н., Беннетт № , Биллинг Л., Томас А., Шаффнер В., Прайс А., Гарг С., Андерсон Э. Дж. Клинические особенности и результаты лечения детей с ослабленным иммунитетом, госпитализированных с лабораторно подтвержденным гриппом в США, 2011-2015 гг. J Pediatric Infec Dis Soc.25 октября 2018 г. doi: 10.1093 / jpids / piy101
  • Чандрасекхар Р., Слоан С., Митчел Е., Нди Д., Олден Н., Томас А., Беннет Н. М. , Кирли П. Д., Хилл М., Андерсон Е. Д., Линфилд Р., Юси-Хиндес К., Баргстен М., Зански С. М., Лунг К., Шредер М., Монро М., Экель С., Маркус TM, Каммингс С.Н., Гарг С., Шаффнер В., Линдегрен М.Л. Социальные детерминанты госпитализации против гриппа в США. Другие Res вирусы гриппа. 2017 ноя; 11 (6): 479-488. DOI: 10.1111 / irv.12483.
  • Арриола С.С., Гарг С., Андерсон Э.Дж., Райан П.А., Джордж А., Зански С.М., Беннетт N , Рейнгольд А., Баргстен М., Миллер Л., Юси-Хиндес К., Татам Л., Бом С.Р., Линфилд Р., Томас А., Линдегрен М.Л., Шаффнер В., Фрай А.М., Чавес СС.Вакцинация против гриппа изменяет тяжесть заболевания среди взрослых, проживающих в общинах, госпитализированных с гриппом. Clin Infect Dis. 2017 г. 19 мая. Doi: 10.1093 / cid / cix468.
  • Аппиа Г.Д., Чавес С.С., Кирли П.Д., Миллер Л., Мик Дж., Андерсон Е., Они О., Райан П., Экель С., Линфилд Р., Баргстен М., Зански С. М., Беннетт № , Лунг К., Макдональд-Хэмм С., Томас А., Брэди Д., Линдегрен М.Л., Шаффнер В., Хилл М., Гарг С., Фрай А.М., Кэмпбелл А.П. Повышение уровня противовирусной терапии среди госпитализированных детей и взрослых с лабораторно подтвержденным гриппом, 2010-2015 гг.Clin Infect Dis. 2017 1 февраля; 64 (3): 364-367.
  • Хэверс Ф., Соколов Л., Шей Д. К., Фарли М. М., Монро М., Мик Дж., Дейли Кирли П., Беннет Н. М. , Морин С., Арагон Д., Томас А., Шаффнер В., Зански С. М., Баумбах Дж., Фердинанд Дж., Фрай ЯВЛЯЮСЬ. Исследование эффективности вакцины в профилактике лабораторно подтвержденных госпитализаций пожилых людей против гриппа методом случай-контроль, США, 2010-2011 гг. Clin Infect Dis. 2016 15 ноября; 63 (10): 1304-1311.

AnnInternMed. DOI: 10.7326 / M20-1509 25 августа 2020 г.

гриппа | Nature Reviews Disease Primers

  • 1.

    Селлерс, С. А., Хаган, Р. С., Хайден, Ф. Г. и Фишер, В. А. 2-й. Скрытое бремя гриппа: обзор внелегочных осложнений гриппа. Influenza Other Respir. Вирусы 11 , 372–393 (2017).

    PubMed PubMed Central Google ученый

  • 2.

    Kwong, J. C. et al. Острый инфаркт миокарда после лабораторно подтвержденного гриппа. N. Engl. Дж.Med. 378 , 345–353 (2018).

    Google ученый

  • 3.

    Мацузаки Ю. и др. Клинические особенности вирусной инфекции гриппа С у детей. J. Infect. Дис. 193 , 1229–1235 (2006).

    Google ученый

  • 4.

    Olsen, B. et al. Глобальные паттерны вируса гриппа А у диких птиц. Наука 312 , 384–388 (2006).

    CAS Google ученый

  • 5.

    Вебстер Р. Г., Бин В. Дж., Горман О. Т., Чемберс Т. М. и Каваока Ю. Эволюция и экология вирусов гриппа А. Microbiol. Ред. 56 , 152–179 (1992).

    CAS PubMed PubMed Central Google ученый

  • 6.

    Тонг, С. и др. Отдельная ветвь вируса гриппа А от летучих мышей. Proc.Natl Acad. Sci. США 109 , 4269–4274 (2012).

    CAS PubMed Google ученый

  • 7.

    Ма, В., Гарсия-Састре, А. и Швеммле, М. Ожидаемые и неожиданные особенности недавно обнаруженных А-подобных вирусов гриппа летучих мышей. PLOS Pathog. 11 , e1004819 (2015).

    Google ученый

  • 8.

    Fouchier, R.A. et al. Характеристика нового подтипа гемагглютинина вируса гриппа А (h26), полученного от черноголовых чаек. J. Virol. 79 , 2814–2822 (2005).

    CAS PubMed PubMed Central Google ученый

  • 9.

    Остерхаус, А. Д., Риммельцваан, Г. Ф., Мартина, Б. Э., Бестеброер, Т. М., Фушье, Р. А. Вирус гриппа B у тюленей. Наука 288 , 1051–1053 (2000).

    CAS Google ученый

  • 10.

    Го, Ю. Дж., Цзинь, Ф.Г., Ван, П., Ван, М. и Чжу, Дж. М. Выделение вируса гриппа С от свиней и экспериментальное заражение свиней вирусом гриппа С. J. Gen. Virol. 64 , 177–182 (1983).

    Google ученый

  • 11.

    Hause, B.M. et al. Выделение нового вируса свиного гриппа в Оклахоме в 2011 году, который отдаленно родственен вирусам гриппа С человека. PLOS Pathog. 9 , e1003176 (2013).

    Google ученый

  • 12.

    Hause, B.M. et al. Характеристика нового вируса гриппа крупного рогатого скота и свиней: предложение о новом роде в семействе Orthomyxoviridae. MBio 5 , e00031–00014 (2014).

    PubMed PubMed Central Google ученый

  • 13.

    Smith, G.J. et al. Происхождение и эволюционная геномика эпидемии гриппа A свиного происхождения 2009 г. Природа 459 , 1122–1125 (2009).

    CAS Google ученый

  • 14.

    Mena, I. et al. Истоки пандемии гриппа h2N1 2009 среди свиней в Мексике. elife 5 , e.16777 (2016). В этом справочнике впервые прослеживается происхождение вируса пандемического гриппа А. .

    Google ученый

  • 15.

    Хайден, Ф.Разработка новых противовирусных препаратов для лечения гриппа: что нас ждет в будущем? Clin. Заразить. Дис. 48 (Приложение 1), S3 – S13 (2009).

    CAS Google ученый

  • 16.

    Hurt, A.C. et al. Устойчивость к противовирусным препаратам во время пандемии гриппа A h2N1 2009 г .: общественное здравоохранение, лабораторные и клинические перспективы. Ланцетная инфекция. Дис. 12 , 240–248 (2012).

    Google ученый

  • 17.

    Rambaut, A. et al. Геномная и эпидемиологическая динамика вируса гриппа человека А. Природа 453 , 615–619 (2008).

    CAS PubMed PubMed Central Google ученый

  • 18.

    Russell, C.A. et al. Глобальная циркуляция вирусов сезонного гриппа A (h4N2). Наука 320 , 340–346 (2008). Вместе со ссылкой 17 это плодотворное исследование предлагает интересные модели того, как вирусы гриппа поддерживаются в человеческой популяции и передаются во всем мире во время сезонных эпидемий .

    CAS Google ученый

  • 19.

    Bahl, J. et al. Динамика структурированной по времени метапопуляции и персистентность вируса гриппа A h4N2 у людей. Proc. Natl Acad. Sci. США 108 , 19359–19364 (2011).

    CAS PubMed Google ученый

  • 20.

    Yu, H. et al. Характеристика региональных моделей сезонности гриппа в Китае и их значение для стратегий вакцинации: пространственно-временное моделирование данных эпиднадзора. PLOS Med. 10 , e1001552 (2013).

    Google ученый

  • 21.

    Центры по контролю и профилактике заболеваний. Предполагаемые заболеваемость гриппом и случаи госпитализации, предотвращенные вакцинацией — США, сезон гриппа 2014–2015 гг. CDC https://www.cdc.gov/flu/about/disease/2014-15.htm (2015).

  • 22.

    Коэн, С. А., Чуй, К. К. и Наумова, Е. Н. Вакцинация детей младшего возраста против гриппа снижает количество госпитализаций, связанных с гриппом, среди пожилых людей, 2002–2006 гг. J. Am. Гериатр. Soc. 59 , 327–332 (2011).

    PubMed PubMed Central Google ученый

  • 23.

    Гостик, К. М., Амброуз, М., Воробей, М. и Ллойд-Смит, Дж. О. Сильная защита от гриппа H5N1 и H7N9 посредством импринтинга детского гемагглютинина. Наука 354 , 722–726 (2016).

    CAS PubMed PubMed Central Google ученый

  • 24.

    Lozano, R. et al. Глобальная и региональная смертность от 235 причин смерти для 20 возрастных групп в 1990 и 2010 годах: систематический анализ для исследования глобального бремени болезней 2010 года. Lancet 380 , 2095–2128 (2012).

    PubMed Google ученый

  • 25.

    Iuliano, A. D. et al. Оценки глобальной респираторной смертности, связанной с сезонным гриппом: модельное исследование. Ланцет 391 , 1285–1300 (2018).

    Google ученый

  • 26.

    Thompson, W. W. et al. Смертность, связанная с гриппом и респираторно-синцитиальным вирусом в США. JAMA 289 , 179–186 (2003). Это исследование представляет собой классический анализ внутрибольничной пневмонии и смертей от гриппа, который устанавливает влияние сезонного гриппа в Соединенных Штатах .

    Google ученый

  • 27.

    Flannery, B. et al. Эффективность вакцины против гриппа против детской смертности: 2010–2014 гг. Педиатрия 139 , https://doi.org/10.1542/peds.2016-4244 (2017).

  • 28.

    Thompson, W. W. et al. Госпитализации, связанные с гриппом, в США. JAMA 292 , 1333–1340 (2004).

    CAS Google ученый

  • 29.

    Walsh, E. E., Cox, C. & Falsey, A. R.Клинические особенности вирусной инфекции гриппа А у госпитализированных лиц пожилого возраста. J. Am. Гериатр. Soc. 50 , 1498–1503 (2002).

    Google ученый

  • 30.

    Jain, S. et al. Госпитализированные пациенты с гриппом 2009 h2N1 в США, апрель-июнь 2009 г. N. Engl. J. Med. 361 , 1935–1944 (2009).

    CAS Google ученый

  • 31.

    Keren, R. et al. Неврологические и нервно-мышечные заболевания как фактор риска дыхательной недостаточности у детей, госпитализированных с гриппом. JAMA 294 , 2188–2194 (2005).

    CAS Google ученый

  • 32.

    Нойзил, К. М., Рид, Г. В., Митчел, Э. Ф., Симонсен, Л. и Гриффин, М. Р. Влияние гриппа на острые сердечно-легочные госпитализации беременных женщин. Am. J. Epidemiol. 148 , 1094–1102 (1998).

    CAS Google ученый

  • 33.

    Van Kerkhove, M. D. et al. Факторы риска тяжелых исходов после инфицирования гриппом A (h2N1) 2009 г .: глобальный объединенный анализ. PLOS Med. 8 , e1001053 (2011).

    Google ученый

  • 34.

    Karlsson, E.A. et al. Идеальный шторм: усиление колонизации и неудачная вакцинация приводят к тяжелой вторичной бактериальной инфекции у инфицированных вирусом гриппа мышей с ожирением. MBio 8 , e00889-17 (2017).

    CAS PubMed PubMed Central Google ученый

  • 35.

    Ciancanelli, M. J. et al. Опасный для жизни грипп и нарушение амплификации интерферона при дефиците IRF7 человека. Наука 348 , 448–453 (2015).

    CAS PubMed PubMed Central Google ученый

  • 36.

    Эверитт, А.R. et al. IFITM3 ограничивает заболеваемость и смертность от гриппа. Природа 484 , 519–523 (2012).

    CAS PubMed PubMed Central Google ученый

  • 37.

    Allen, E. K. et al. SNP-опосредованное нарушение связывания CTCF на промоторе IFITM3 связано с риском тяжелого гриппа у людей. Нац. Med. 23 , 975–983 (2017).

    CAS PubMed PubMed Central Google ученый

  • 38.

    van Gils, J. A. et al. Затруднение в поисках пищи и миграции у лебедей, инфицированных низкопатогенным вирусом птичьего гриппа А. PLOS ONE 2 , e184 (2007).

    Google ученый

  • 39.

    Гуан Ю. и Смит Г. Дж. Возникновение и диверсификация вирусов панзоотического гриппа H5N1. Virus Res. 178 , 35–43 (2013).

    CAS PubMed PubMed Central Google ученый

  • 40.

    IP, H. S. et al. Новые евразийские высокопатогенные вирусы птичьего гриппа A H5 у диких птиц, Вашингтон, США, 2014. Emerg. Заразить. Дис. 21 , 886–890 (2015).

    CAS PubMed PubMed Central Google ученый

  • 41.

    Ke, C. et al. Заражение человека высокопатогенным вирусом птичьего гриппа A (H7N9). Китай. Emerg. Заразить. Дис. 23 , 1332–1340 (2017).

    CAS Google ученый

  • 42.

    Ли, К. Т. и др. Вспышка гриппа A (H7N2) среди кошек в приюте для животных с передачей от кошки человеку — Нью-Йорк, 2016. Clin. Заразить. Дис. 65 , 1927–1929 (2017).

    Google ученый

  • 43.

    Fouchier, R.A. et al. Вирус птичьего гриппа A (H7N7), связанный с конъюнктивитом человека, и смертельный случай острого респираторного дистресс-синдрома. Proc. Natl Acad. Sci. США 101 , 1356–1361 (2004).

    CAS PubMed Google ученый

  • 44.

    Перкинс Л. Э. и Суэйн Д. Э. Патогенность высокопатогенного вируса гриппа птиц H5N1 гонконгского происхождения для страусов эму, гусей, уток и голубей. Avian Dis. 46 , 53–63 (2002).

    Google ученый

  • 45.

    Hulse-Post, D. J. et al. Роль домашних уток в распространении и биологической эволюции высокопатогенных вирусов гриппа H5N1 в Азии. Proc. Natl Acad. Sci. США 102 , 10682–10687 (2005).

    CAS PubMed Google ученый

  • 46.

    Fournie, G. et al. Вмешательства по управлению рисками птичьего гриппа A (H5N1) в сетях рынка живой птицы. Proc. Natl Acad. Sci. США 110 , 9177–9182 (2013).

    CAS PubMed Google ученый

  • 47.

    Винсент, А.и другие. Обзор вируса гриппа А среди свиней во всем мире: призыв к усилению эпиднадзора и исследований. Zoonoses Publ. Здравоохранение 61 , 4–17 (2014).

    CAS Google ученый

  • 48.

    Нойманн Г. и Каваока Ю. Первая пандемия гриппа в новом тысячелетии. Influenza Other Respir. Вирусы 5 , 157–166 (2011).

    PubMed PubMed Central Google ученый

  • 49.

    Jhung, M.A. et al. Вспышка варианта вируса гриппа A (h4N2) в США. Clin. Заразить. Дис. 57 , 1703–1712 (2013).

    CAS PubMed PubMed Central Google ученый

  • 50.

    Crawford, P.C. et al. Передача вируса гриппа лошадей собакам. Наука 310 , 482–485 (2005).

    CAS Google ученый

  • 51.

    Li, S. et al. Вирусы птичьего гриппа h4N2 собачьего гриппа А в Южном Китае. Заражение. Genet. Evol. 10 , 1286–1288 (2010).

    PubMed PubMed Central Google ученый

  • 52.

    Yamada, S. et al. Мутации гемагглютинина, ответственные за связывание вирусов гриппа A H5N1 с рецепторами человеческого типа. Природа 444 , 378–382 (2006).

    CAS Google ученый

  • 53.

    van Riel, D. et al. Прикрепление вируса H5N1 к нижним дыхательным путям. Наука 312 , 399 (2006).

    Google ученый

  • 54.

    Херст, Г. К. Исследования антигенных различий между штаммами гриппа А с помощью агглютинации эритроцитов. J. Exp. Med. 78 , 407–423 (1943).

    CAS PubMed PubMed Central Google ученый

  • 55.

    Barr, I. G. et al. Рекомендации ВОЗ по вирусам, использованным в вакцине против гриппа для Северного полушария 2013–2014 гг .: эпидемиология, антигенные и генетические характеристики вирусов гриппа A (h2N1) pdm09, A (h4N2) и B, собранные с октября 2012 г. по январь 2013 г. Вакцина 32, , 4713–4725 (2014).

    Google ученый

  • 56.

    Sandbulte, M. R. et al. Дискордантный антигенный дрейф нейраминидазы и гемагглютинина в вирусах гриппа h2N1 и h4N2. Proc. Natl Acad. Sci. США 108 , 20748–20753 (2011).

    CAS PubMed Google ученый

  • 57.

    Килборн, Э. Д., Лейвер, У. Г., Шульман, Дж. Л. и Вебстер, Р. Г. Противовирусная активность антисыворотки, специфичной для нейраминидазы вируса гриппа. J. Virol. 2 , 281–288 (1968).

    CAS PubMed PubMed Central Google ученый

  • 58.

    Couzens, L. et al. Оптимизированный ферментно-связанный анализ лектина для измерения титров антител, ингибирующих нейраминидазу вируса гриппа А, в сыворотке крови человека. J. Virol. Методы 210 , 7–14 (2014).

    CAS Google ученый

  • 59.

    Voeten, J. T. et al. Антигенный дрейф в нуклеопротеине вируса гриппа A (h4N2) и ускользание от распознавания цитотоксическими Т-лимфоцитами. J. Virol. 74 , 6800–6807 (2000).

    CAS PubMed PubMed Central Google ученый

  • 60.

    Smith, D. J. et al. Картирование антигенной и генетической эволюции вируса гриппа. Наука 305 , 371–376 (2004). Это исследование описывает концепцию антигенной картографии и использует антигенную картографию для визуализации и количественной оценки антигенного дрейфа вирусов гриппа A человека h4N2 за 35 лет .

    CAS Google ученый

  • 61.

    Koel, B. F. et al. Замены возле сайта связывания рецептора определяют основные антигенные изменения во время эволюции вируса гриппа. Наука 342 , 976–979 (2013).

    CAS Google ученый

  • 62.

    Koel, B. F. et al. Антигенная изменчивость вируса клады 2.1 H5N1 определяется несколькими аминокислотными заменами, непосредственно примыкающими к сайту связывания рецептора. МБио 5 , e01070-01014 (2014).

    PubMed PubMed Central Google ученый

  • 63.

    Lewis, N. S. et al. Антигенная и генетическая эволюция вируса гриппа лошадей A (h4N8) с 1968 по 2007 год. J. Virol. 85 , 12742–12749 (2011).

    CAS PubMed PubMed Central Google ученый

  • 64.

    de Jong, J. C. et al. Антигенная и генетическая эволюция вирусов свиного гриппа A (h4N2) в Европе. J. Virol. 81 , 4315–4322 (2007).

    PubMed PubMed Central Google ученый

  • 65.

    Кендал, А. П., Нобл, Г. Р., Скехел, Дж. Дж. И Даудл, У. Р. Антигенное сходство вирусов гриппа A (h2N1) эпидемий 1977–1978 годов со «скандинавскими» штаммами, выделенными во время эпидемий 1950–1951 годов. Вирусология 89 , 632–636 (1978).

    CAS Google ученый

  • 66.

    Herfst, S. et al. Передача вируса гриппа A / H5N1 воздушно-капельным путем между хорьками. Наука 336 , 1534–1541 (2012).

    CAS PubMed PubMed Central Google ученый

  • 67.

    Imai, M. et al. Экспериментальная адаптация HA гриппа H5 вызывает респираторно-капельную передачу реассортантному вирусу H5 HA / h2N1 у хорьков. Природа 486 , 420–428 (2012).

    CAS PubMed PubMed Central Google ученый

  • 68.

    Russell, C.A. et al. Возможность эволюции вируса гриппа A / H5N1, передаваемого через дыхательные пути, в организме млекопитающего-хозяина. Наука 336 , 1541–1547 (2012).

    CAS PubMed PubMed Central Google ученый

  • 69.

    Юн, С. В., Уэбби, Р. Дж. И Вебстер, Р. Г. Эволюция и экология вирусов гриппа А. Curr. Верхний. Microbiol. Иммунол. 385 , 359–375 (2014).

    Google ученый

  • 70.

    Вебстер Р. Г. и Халс Д. Дж. Микробная адаптация и изменение: птичий грипп. Rev. Sci. Tech. 23 , 453–465 (2004).

    CAS Google ученый

  • 71.

    Андино Р. и Доминго Э. Вирусные квазивиды. Вирусология 479–480 , 46–51 (2015).

    PubMed PubMed Central Google ученый

  • 72.

    Tumpey, T. M. et al. Замена двух аминокислот в гемагглютинине вируса гриппа 1918 г. отменяет передачу. Наука 315 ​​, 655–659 (2007). Это исследование предоставляет первое доказательство того, что рецепторная специфичность HA вируса гриппа A играет важную роль в респираторной передаче этих вирусов .

    CAS Google ученый

  • 73.

    Mitnaul, L.J. et al. Сбалансированная активность гемагглютинина и нейраминидазы имеет решающее значение для эффективной репликации вируса гриппа А. J. Virol. 74 , 6015–6020 (2000).

    CAS PubMed PubMed Central Google ученый

  • 74.

    Reed, M. L. et al. Уровень pH активации белка гемагглютинина регулирует патогенность и трансмиссивность вируса гриппа H5N1 у уток. J. Virol. 84 , 1527–1535 (2010).

    CAS Google ученый

  • 75.

    Хатта, М., Гао, П., Халфманн, П. и Каваока, Ю. Молекулярная основа высокой вирулентности вирусов гонконгского гриппа A H5N1. Наука 293 , 1840–1842 (2001).

    CAS Google ученый

  • 76.

    Меле, А. и Дудна, Дж. А. Адаптивные стратегии полимеразы вируса гриппа для репликации в организме человека. Proc. Natl Acad. Sci. США 106 , 21312–21316 (2009).

    CAS PubMed Google ученый

  • 77.

    Riegger, D. et al. Нуклеопротеин недавно возникшего вируса гриппа H7N9 содержит уникальный мотив, придающий устойчивость к противовирусному MxA человека. J. Virol. 89 , 2241–2252 (2015).

    Google ученый

  • 78.

    Campbell, P.J. et al. Сегмент M вируса пандемического гриппа 2009 года обеспечивает повышенную активность нейраминидазы, нитевидную морфологию и эффективную контактную передачу реассортантным вирусам на основе A / Puerto Rico / 8/1934. J. Virol. 88 , 3802–3814 (2014).

    PubMed PubMed Central Google ученый

  • 79.

    Медина, Р. А. и Гарсия-Састре, А. Вирусы гриппа А: новые исследовательские разработки. Нац. Rev. Microbiol. 9 , 590–603 (2011).

    CAS Google ученый

  • 80.

    Tong, S. et al. Летучие мыши Нового Света являются носителями различных вирусов гриппа А. PLOS Pathog. 9 , e1003657 (2013).

    Google ученый

  • 81.

    Moreira, E.A. et al. Синтетически полученные вирусы гриппа летучих мышей типа А обнаруживают тропизм, специфичный для клеточного типа, но не видоспецифичный. Proc. Natl Acad. Sci. США 113 , 12797–12802 (2016).

    CAS PubMed Google ученый

  • 82.

    Mibayashi, M. et al.Ингибирование индуцируемой ретиноевой кислотой гена I-опосредованной индукции бета-интерферона белком NS1 вируса гриппа А. J. Virol. 81 , 514–524 (2007).

    CAS Google ученый

  • 83.

    Pichlmair, A. et al. RIG-I-опосредованные противовирусные ответы на одноцепочечную РНК, несущую 5′-фосфаты. Наука 314 , 997–1001 (2006).

    CAS Google ученый

  • 84.

    Rajsbaum, R. et al. Видоспецифическое ингибирование убиквитинирования RIG-I и индукции IFN белком NS1 вируса гриппа А. PLOS Pathog. 8 , e1003059 (2012).

    Google ученый

  • 85.

    Nemeroff, ME, Barabino, SM, Li, Y., Keller, W. & Krug, RM Белок NS1 вируса гриппа взаимодействует с клеточной 30 кДа субъединицей CPSF и ингибирует 3′-концевое образование клеточных пре- мРНК. Мол.Cell 1 , 991–1000 (1998).

    CAS Google ученый

  • 86.

    Satterly, N. et al. Вирус гриппа нацелен на механизм экспорта мРНК и комплекс ядерных пор. Proc. Natl Acad. Sci. США 104 , 1853–1858 (2007).

    CAS PubMed Google ученый

  • 87.

    Marazzi, I. et al. Подавление противовирусного ответа имитатором гриппа. Природа 483 , 428–433 (2012).

    CAS PubMed PubMed Central Google ученый

  • 88.

    Chauche, C. et al. Адаптация у млекопитающих вируса птичьего гриппа A включает ступенчатые изменения NS1. J. Virol. e01875-17 (2017).

  • 89.

    Li, S., Min, J. Y., Krug, R. M. & Sen, G. C. Связывание белка NS1 вируса гриппа A с PKR опосредует ингибирование его активации либо PACT, либо двухцепочечной РНК. Вирусология 349 , 13–21 (2006).

    CAS Google ученый

  • 90.

    Мин, Дж. Й. и Круг, Р. М. Основная функция связывания РНК белком NS1 вируса гриппа A в инфицированных клетках: ингибирование пути 2′-5′-олиго (A) синтетазы / РНКазы L. Proc. Natl Acad. Sci. США 103 , 7100–7105 (2006).

    CAS PubMed Google ученый

  • 91.

    Коненелло, Г. М. и Палезе, П. Вирус гриппа А PB1-F2: небольшой белок с большим ударом. Cell Host Microbe 2 , 207–209 (2007).

    CAS Google ученый

  • 92.

    Graef, K. M. et al. Субъединица PB2 РНК-полимеразы вируса гриппа влияет на вирулентность, взаимодействуя с митохондриальным антивирусным сигнальным белком и подавляя экспрессию бета-интерферона. J. Virol. 84 , 8433–8445 (2010).

    CAS PubMed PubMed Central Google ученый

  • 93.

    Jagger, B. W. et al. Перекрывающаяся кодирующая белок область в сегменте 3 вируса гриппа А модулирует ответ хозяина. Наука 337 , 199–204 (2012).

    CAS PubMed PubMed Central Google ученый

  • 94.

    Crotta, S. et al. Интерфероны типа I и типа III управляют избыточными петлями амплификации для индукции транскрипционной сигнатуры в инфицированном гриппом эпителии дыхательных путей. PLOS Pathog. 9 , e1003773 (2013).

    Google ученый

  • 95.

    Helft, J. et al. Кросс-презентирующие дендритные клетки CD103 + защищены от заражения вирусом гриппа. J. Clin. Инвестировать. 122 , 4037–4047 (2012).

    CAS PubMed PubMed Central Google ученый

  • 96.

    Zhu, L. et al. Высокий уровень внеклеточных ловушек нейтрофилов коррелирует с плохим прогнозом тяжелой инфекции гриппа А. J. Infect. Дис. 217 , 428–437 (2018).

    CAS Google ученый

  • 97.

    Walsh, K. B. et al. Подавление цитокинового шторма аналогом сфингозина обеспечивает защиту от патогенного вируса гриппа. Proc. Natl Acad. Sci. США 108 , 12018–12023 (2011).

    CAS PubMed Google ученый

  • 98.

    Шридхар, С.и другие. Клеточные иммунные корреляты защиты от симптоматического пандемического гриппа. Нац. Med. 19 , 1305–1312 (2013).

    CAS Google ученый

  • 99.

    Wilkinson, T. M. et al. Существующие ранее гриппоспецифические CD4 + Т-клетки коррелируют с защитой человека от заражения гриппом. Нац. Med. 18 , 274–280 (2012).

    CAS Google ученый

  • 100.

    Quinones-Parra, S. et al. Предшествующий CD8 + Т-клеточный иммунитет к вирусу гриппа A H7N9 варьируется в зависимости от этнической принадлежности. Proc. Natl Acad. Sci. США 111 , 1049–1054 (2014).

    CAS PubMed Google ученый

  • 101.

    Wang, Z. et al. Выздоровление от тяжелого заболевания H7N9 связано с различными механизмами ответа, в которых доминируют CD8 + Т-клетки. Нац. Commun. 6 , 6833 (2015). Эта рукопись свидетельствует о том, что ранняя перекрестная реакция CD8 + Т-клеточный иммунитет играет важную роль в выздоровлении от тяжелого птичьего гриппа A H7N9, вызванного вирусом .

    CAS PubMed PubMed Central Google ученый

  • 102.

    van de Sandt, C.E. et al. CD8 + Т-клеточный ответ, специфичный для вируса гриппа A человека, является долгоживущим. J. Infect. Дис. 212 , 81–85 (2015).

    PubMed PubMed Central Google ученый

  • 103.

    Сан, Дж. К. и Беван М. Дж. Нарушение памяти Т-лимфоцитов CD8 после острой инфекции без помощи Т-лимфоцитов CD4. Наука 300 , 339–342 (2003).

    CAS PubMed PubMed Central Google ученый

  • 104.

    McKinstry, K. K. et al. Память CD4 + Т-клетки защищают от гриппа с помощью множества синергетических механизмов. J. Clin. Инвестировать. 122 , 2847–2856 (2012).

    CAS PubMed PubMed Central Google ученый

  • 105.

    Deliyannis, G. et al. Интраназальный липопептид активирует резидентные в легких CD8 + Т-клетки памяти для долгосрочной защиты легких от гриппа. евро. J. Immunol. 36 , 770–778 (2006).

    CAS Google ученый

  • 106.

    Pejoski, D., Zeng, W., Rockman, S., Brown, L.E. и Jackson, D.C. Липопептид на основе белков M2 и HA вирусов гриппа A индуцирует защитные антитела. Immunol. Клетка. Биол. 88 , 605–611 (2010).

    CAS Google ученый

  • 107.

    Мак-Майкл, А. Дж., Готч, Ф. М., Ноубл, Г. Р., Беар, П. А. Цитотоксический Т-клеточный иммунитет к гриппу. N. Engl. J. Med. 309 , 13–17 (1983).

    CAS Google ученый

  • 108.

    Topham, D. J., Tripp, R. A. и Doherty, P. C. CD8 + Т-клетки очищают вирус гриппа с помощью перфорин или Fas-зависимых процессов. J. Immunol. 159 , 5197–5200 (1997).

    CAS Google ученый

  • 109.

    Доэрти, П. К., Тернер, С. Дж., Уэбби, Р. Г. и Томас, П. Г. Грипп и проблема иммунологии. Нац. Иммунол. 7 , 449–455 (2006).

    CAS Google ученый

  • 110.

    Шридхар, С., Брокстад, К. А. и Кокс, Р. Дж. Стратегии вакцинации против гриппа: сравнение инактивированных и живых аттенуированных вакцин против гриппа. Вакцины 3 , 373–389 (2015).

    CAS PubMed PubMed Central Google ученый

  • 111.

    Русь, Б.E. et al. Четкие эпигенетические сигнатуры очерчивают программы транскрипции во время вирус-специфической дифференцировки Т-клеток CD8 + . Иммунитет 41 , 853–865 (2014).

    CAS PubMed PubMed Central Google ученый

  • 112.

    Valkenburg, S.A. et al. Раннее праймирование сводит к минимуму связанный с возрастом иммунный компромисс разнообразия и функции Т-клеток CD8 + . PLOS Pathog. 8 , e1002544 (2012).

    Google ученый

  • 113.

    Смит В., Эндрюс К. Х. и Лейдлоу П. П. Вирус, полученный от больных гриппом. Ланцет 222 , 66–68 (1933). Это исследование описывает первое выделение вируса гриппа. Важно отметить, что он включает доказательство защиты от заражения вирусом гриппа путем пассивной передачи антител на модели гриппа у хорька.

    Google ученый

  • 114.

    Wrammert, J. et al. Быстрое клонирование высокоаффинных моноклональных антител человека против вируса гриппа. Природа 453 , 667–671 (2008).

    CAS PubMed PubMed Central Google ученый

  • 115.

    Gerhard, W., Yewdell, J., Frankel, M.E. & Webster, R. Антигенная структура гемагглютинина вируса гриппа, определяемая гибридомными антителами. Nature 290 , 713–717 (1981).

    CAS Google ученый

  • 116.

    Angeletti, D. et al. Определение иммунодоминантности В-клеток к вирусам. Нац. Иммунол. 18 , 456–463 (2017).

    CAS PubMed PubMed Central Google ученый

  • 117.

    Andrews, S. F. et al. Иммунный анамнез в значительной степени влияет на защитные реакции В-клеток на грипп. Sci. Transl Med. 7 , 316ra192 (2015).

    PubMed PubMed Central Google ученый

  • 118.

    Hobson, D., Curry, R.L., Beare, A. S. и Ward-Gardner, A. Роль сывороточных антител, ингибирующих гемагглютинацию, в защите от контрольной инфекции вирусами гриппа A2 и B. J. Hyg. 70 , 767–777 (1972).

    CAS PubMed Google ученый

  • 119.

    Yu, X. et al. Нейтрализующие антитела, полученные из В-клеток выживших после пандемии гриппа 1918 года. Природа 455 , 532–536 (2008).

    CAS PubMed PubMed Central Google ученый

  • 120.

    Группа по исследованию нового вируса гриппа свиного происхождения A et al. Появление у людей нового вируса гриппа свиного происхождения (h2N1). N. Engl. J. Med. 360 , 2605–2615 (2009).

    Google ученый

  • 121.

    Manicassamy, B. et al. Защита мышей от летального заражения вирусом гриппа A 2009 h2N1 с помощью вакцин, подобных 1918, и классических вакцин на основе h2N1 свиней. PLOS Pathog. 6 , e1000745 (2010).

    Google ученый

  • 122.

    Steens, A. et al. Возрастозависимые модели инфекции и тяжесть, объясняющие низкое воздействие гриппа A (h2N1) 2009 г.: данные серийных серологических исследований в Нидерландах. Am. J. Epidemiol. 174 , 1307–1315 (2011).

    Google ученый

  • 123.

    Хитон, Н. С., Сакс, Д., Чен, К. Дж., Хай, Р. и Палезе, П. Полногеномный мутагенез вируса гриппа показывает уникальную пластичность гемагглютинина и белков NS1. Proc. Natl Acad. Sci. США 110 , 20248–20253 (2013).

    CAS PubMed Google ученый

  • 124.

    Доуд, М. Б. и Блум, Дж. Д. Точное измерение эффектов всех аминокислотных мутаций на гемагглютинин гриппа. Вирусов 8 , 155 (2016).

    Google ученый

  • 125.

    Монто, А. С., Малош, Р. Э., Петри, Дж. Г. и Мартин, Э. Т. Доктрина изначального антигенного греха: отделение добра от зла. J. Infect. Дис. 215 , 1782–1788 (2017).

    PubMed PubMed Central Google ученый

  • 126.

    Генри К., Палм А. Э., Краммер Ф. и Уилсон П. С. От первоначального антигенного греха к универсальной вакцине против вируса гриппа. Trends Immunol. 39 , 70–79 (2017).

    PubMed PubMed Central Google ученый

  • 127.

    Linderman, S. L. et al. Возможное антигенное объяснение атипичных инфекций h2N1 среди взрослых среднего возраста в сезон гриппа 2013–2014 гг. Proc. Natl Acad. Sci.США 111 , 15798–15803 (2014).

    CAS PubMed Google ученый

  • 128.

    Li, Y. et al. Иммунный анамнез определяет специфичность ответов антител к пандемическому гриппу h2N1. J. Exp. Med. 210 , 1493–1500 (2013).

    CAS PubMed PubMed Central Google ученый

  • 129.

    Краммер Ф. и Палезе П. Антитела и вакцины на основе стеблей гемагглютинина вируса гриппа. Curr. Opin. Virol. 3 , 521–530 (2013).

    CAS PubMed PubMed Central Google ученый

  • 130.

    Ekiert, D. C. & Wilson, I. A. Широко нейтрализующие антитела против вируса гриппа и перспективы универсальных методов лечения. Curr. Opin. Virol. 2 , 134–141 (2012).

    CAS PubMed PubMed Central Google ученый

  • 131.

    Neirynck, S. et al. Универсальная вакцина против гриппа А на основе внеклеточного домена белка M2. Нац. Med. 5 , 1157–1163 (1999).

    CAS Google ученый

  • 132.

    Wohlbold, T. J. et al. Широко защищающие мышиные моноклональные антитела против вируса гриппа B нацелены на высококонсервативные эпитопы нейраминидазы. Нац. Microbiol. 2 , 1415–1424 (2017).

    CAS PubMed PubMed Central Google ученый

  • 133.

    Wan, H. et al. Молекулярная основа широкого нейраминидазного иммунитета: консервативные эпитопы сезонных и пандемических вирусов h2N1, а также вирусов гриппа H5N1. J. Virol. 87 , 9290–9300 (2013).

    CAS PubMed PubMed Central Google ученый

  • 134.

    Rajendran, M. et al. Анализ антител к нейраминидазе вируса гриппа у детей, взрослых и пожилых людей с помощью ELISA и ингибирования ферментов: доказательства изначального антигенного греха. MBio 8 , https://doi.org/10.1128/mBio.02281-16 (2017).

  • 135.

    Вольболд Т. Дж. И Краммер Ф. В тени гемагглютинина: растущий интерес к нейраминидазе вируса гриппа и ее роли в качестве антигена вакцины. Вирусы 6 , 2465–2494 (2014).

    PubMed PubMed Central Google ученый

  • 136.

    ДиЛилло, Д. Дж., Палезе, П., Уилсон, П. К. и Раветч, Дж.V. Широко нейтрализующие антитела против гриппа требуют включения рецептора Fc для защиты in vivo. J. Clin. Инвестировать. 126 , 605–610 (2016). Это исследование демонстрирует, что иммунные ответы, индуцированные против консервативного домена HA вируса гриппа, включают широко защищающие антитела, которые активируют эффекторные клетки посредством взаимодействий Fc – FcR.

    PubMed PubMed Central Google ученый

  • 137.

    Jegaskanda, S. et al. Перекрестно-реактивные антитела к гриппу, зависимые от клеточной цитотоксичности, антитела в отсутствие нейтрализующих антител. J. Immunol. 190 , 1837–1848 (2013).

    CAS Google ученый

  • 138.

    Jegaskanda, S., Weinfurter, J. T., Friedrich, T. C. & Kent, S. J. Антителозависимая клеточная цитотоксичность связана с контролем пандемического инфицирования макак вирусом гриппа h2N1. J. Virol. 87 , 5512–5522 (2013).

    CAS PubMed PubMed Central Google ученый

  • 139.

    Seibert, C. W. et al. Рекомбинантного IgA достаточно для предотвращения передачи вируса гриппа морским свинкам. J. Virol. 87 , 7793–7804 (2013).

    CAS PubMed PubMed Central Google ученый

  • 140.

    Лоуэн, А.C. et al. Блокирование передачи вируса гриппа между хозяевами путем вакцинации на модели морской свинки. J. Virol. 83 , 2803–2818 (2009).

    CAS PubMed PubMed Central Google ученый

  • 141.

    Ohmit, S. E. и Monto, A. S. Симптоматические предикторы положительности вируса гриппа у детей во время сезона гриппа. Clin. Заразить. Дис. 43 , 564–568 (2006).

    Google ученый

  • 142.

    Кумар, С. и Хенриксон, К. Дж. Обновленная информация о диагностике гриппа: уроки новой пандемии гриппа h2N1 A. Clin. Microbiol. Ред. 25 , 344–361 (2012).

    CAS PubMed PubMed Central Google ученый

  • 143.

    Петрич М., Команор Л. и Петти К. А. Роль лаборатории в диагностике гриппа во время сезонных эпидемий и потенциальных пандемий. J. Infect. Дис. 194 (Доп.2), S98 – S110, https://doi.org/10.1086/507554 (2006).

    Google ученый

  • 144.

    Ньютон, Д. У., Тринор, Дж. Дж. И Менегус, М. А. Клиническая и лабораторная диагностика вирусных инфекций гриппа. Am. J. Manag. Уход 6 , S265 – S275 (2000).

    CAS Google ученый

  • 145.

    Данн, Дж. Дж., Вулстенхалм, Р. Д., Лангер, Дж. И Кэрролл, К.C. Чувствительность культуры респираторного вируса при скрининге свежих клеток R-mix. J. Clin. Microbiol. 42 , 79–82 (2004).

    PubMed PubMed Central Google ученый

  • 146.

    Nie, S. et al. Оценка Alere i Influenza A&B для быстрого обнаружения вирусов гриппа A и B. J. Clin. Microbiol. 52 , 3339–3344 (2014).

    CAS PubMed PubMed Central Google ученый

  • 147.

    Merckx, J. et al. Диагностическая точность новых и традиционных экспресс-тестов на грипп по сравнению с полимеразной цепной реакцией с обратной транскриптазой: систематический обзор и метаанализ. Ann. Междунар. Med. 167 , 394–409 (2017).

    Google ученый

  • 148.

    Bhattacharya, S. et al. Транскриптомные биомаркеры, позволяющие отличить бактериальную инфекцию от небактериальной у взрослых, госпитализированных с респираторным заболеванием. Sci. Отчет 7 , 6548 (2017).

    PubMed PubMed Central Google ученый

  • 149.

    Солк, Дж. Э. и Суриано П. С. Важность антигенного состава вакцины против вируса гриппа в защите от естественного заболевания; наблюдения зимой 1947–1948 гг. Am. J. Publ. Здоровье Нат. Здравоохранение 39 , 345–355 (1949).

    CAS Google ученый

  • 150.

    Плоткин С.А., Оренштейн В. и Оффит П. (ред.), Vaccines 6 th edn (Saunders, 2012)

  • 151.

    Руденко Л., Еолекар Л., Киселева И. и Исакова-Сивак И. Разработка и апробация живых аттенуированных противогриппозных вакцин на основе российских мастер-вирусов-доноров: проблемы процесса и истории успеха. Вакцина 34 , 5436–5441 (2016).

    PubMed PubMed Central Google ученый

  • 152.

    Каспард, Х., Мэллори, Р. М., Ю, Дж. И Амброуз, К. С. Эффективность живой аттенуированной противогриппозной вакцины у детей с 2009 по 2015-2016 годы: систематический обзор и метаанализ. Заражение открытого форума. Дис. 4 , оф111 (2017).

    PubMed PubMed Central Google ученый

  • 153.

    Manini, I. et al. Вакцины против гриппа и вакцины-кандидаты, не зависящие от яиц. Вакцины 5 , 18 (2017).

    Google ученый

  • 154.

    Центры по контролю и профилактике заболеваний. Вакцина против сезонного гриппа (гриппа) Флублок. CDC https://www.cdc.gov/flu/protect/vaccine/qa_flublok-vaccine.htm (2017).

  • 155.

    Clark, T. W. et al. Испытание моновалентной вакцины с адъювантом против гриппа A (h2N1) 2009 г. N. Engl. J. Med. 361 , 2424–2435 (2009).

    CAS Google ученый

  • 156.

    Nohynek, H. et al. Вакцина Ah2N1 с адъювантом AS03 связана с резким увеличением заболеваемости детской нарколепсией в Финляндии. PLOS ONE 7 , e33536 (2012).

    Google ученый

  • 157.

    DiazGranados, C.A. et al. Эффективность вакцины против гриппа в высоких дозах по сравнению со стандартной дозой у пожилых людей. N. Engl. J. Med. 371 , 635–645 (2014).

    Google ученый

  • 158.

    Enami, M., Luytjes, W., Krystal, M. и Palese, P. Введение сайт-специфических мутаций в геном вируса гриппа. Proc. Natl Acad. Sci. США 87 , 3802–3805 (1990).

    CAS PubMed Google ученый

  • 159.

    Краммер Ф. и Палезе П. Достижения в разработке вакцин против вируса гриппа. Нац. Rev. Drug Discov. 14 , 167–182 (2015).

    CAS Google ученый

  • 160.

    Полес, К. И., Марстон, Х. Д., Эйзингер, Р. В., Балтимор, Д. и Фаучи, А. С. Путь к универсальной вакцине против гриппа. Иммунитет 47 , 599–603 (2017).

    CAS Google ученый

  • 161.

    Комитет по инфекционным болезням. Рекомендации по профилактике гриппа у детей и борьбе с ним, 2017–2018 гг. Педиатрия 140 , e20172550 (2017).

    Google ученый

  • 162.

    Палезе, П. и Ван, Т. Т. Вирусы гриппа H5N1: факты, а не страхи. Proc. Natl Acad. Sci. США 109 , 2211–2213 (2012).

    CAS PubMed Google ученый

  • 163.

    Gomaa, M. R. et al. Распространенность птичьего гриппа A (H5N1) и A (H9N2) и факторы риска инфицирования среди египтян: проспективное контролируемое сероэпидемиологическое исследование. J. Infect. Дис. 211 , 1399–1407 (2015).

    Google ученый

  • 164.

    Ван Т. Т., Паридес М. К. и Палезе П. Серодоказательства инфекций гриппа H5N1 у людей: метаанализ. Наука 335 , 1463 (2012).

    CAS PubMed PubMed Central Google ученый

  • 165.

    Varble, A. et al. Узкие места передачи вируса гриппа А определяются маршрутом заражения и хозяином-реципиентом. Cell Host Microbe 16 , 691–700 (2014).

    CAS PubMed PubMed Central Google ученый

  • 166.

    Собель Леонард, А., Вайсман, Д. Б., Гринбаум, Б., Гедин, Э. и Коелле, К. Оценка размера узкого места передачи по данным глубокого секвенирования патогенов применительно к вирусу гриппа человека А. J. Virol. 91 , e00171-17 (2017).

    PubMed PubMed Central Google ученый

  • 167.

    Остерхольм, М. Т., Келли, Н. С., Соммер, А. и Белонгиа, Е. А. Эффективность и действенность противогриппозных вакцин: систематический обзор и метаанализ. Ланцетная инфекция. Дис. 12 , 36–44 (2012).

    Google ученый

  • 168.

    ДиазГранадос, К. А., Денис, М. и Плоткин, С. Эффективность вакцины против сезонного гриппа и ее детерминанты у детей и взрослых людей пожилого возраста: систематический обзор с метаанализом контролируемых испытаний. Вакцина 31 , 49–57 (2012).

    Google ученый

  • 169.

    Beyer, W. E. et al. Ответ: Письмо в редакцию, Кокрейн переделал. Вакцина 33 , 13–14 (2015).

    CAS Google ученый

  • 170.

    Центры по контролю и профилактике заболеваний. ACIP отвергает использование LAIV в сезон гриппа 2016–2017 гг. CDC https: // www.cdc.gov/media/releases/2016/s0622-laiv-flu.html (2016).

  • 171.

    Saito, N. et al. Негативное влияние предыдущей вакцинации против гриппа на текущую вакцинацию против гриппа среди людей, инфицированных и не инфицированных в предыдущем сезоне: исследование случай-контроль с отрицательным результатом в Японии. Вакцина 35 , 687–693 (2017).

    Google ученый

  • 172.

    Полес, К. И., Салливан, С. Г., Суббарао, К. и Фаучи, А. С.В погоне за сезонным гриппом — необходимость универсальной вакцины против гриппа. N. Engl. J. Med. 378 , 7–9 (2018).

    Google ученый

  • 173.

    Хата, А., Акаси-Уэда, Р., Такамацу, К. и Мацумура, Т. Безопасность и эффективность перамивира для лечения гриппа. Препарат. Des. Dev. Ther. 8 , 2017–2038 (2014).

    Google ученый

  • 174.

    МакКимм-Брешкин, Дж. Л. Ингибиторы нейраминидазы гриппа: противовирусное действие и механизмы устойчивости. Influenza Other Respir. Вирусы 7 (Приложение 1), 25–36 (2013).

    CAS Google ученый

  • 175.

    Околи, Г. Н., Отете, Х. Э., Бек, К. Р. и Нгуен-Ван-Там, Дж. С. Использование ингибиторов нейраминидазы для быстрого сдерживания гриппа: систематический обзор и метаанализ исследований передачи инфекции на отдельных лицах и в домах. PLOS ONE 9 , e113633 (2014).

    Google ученый

  • 176.

    Muthuri, S. G. et al. Эффективность ингибиторов нейраминидазы в снижении смертности у пациентов, госпитализированных с инфекцией вируса гриппа A h2N1pdm09: метаанализ данных отдельных участников. Ланцет Респир. Med. 2 , 395–404 (2014).

    CAS PubMed PubMed Central Google ученый

  • 177.

    Добсон, Дж., Уитли, Р. Дж., Покок, С. и Монто, А. С. Лечение осельтамивиром от гриппа у взрослых: метаанализ рандомизированных контролируемых испытаний. Ланцет 385 , 1729–1737 (2015).

    CAS Google ученый

  • 178.

    Venkatesan, S. et al. Влияние амбулаторного лечения ингибиторами нейраминидазы у пациентов, инфицированных гриппом A (h2N1) pdm09 с высоким риском госпитализации: метаанализ данных отдельных участников. Clin. Заразить. Дис. 64 , 1328–1334 (2017).

    CAS PubMed PubMed Central Google ученый

  • 179.

    Deyde, V. M. et al. Эпиднадзор за устойчивостью к адамантанам среди вирусов гриппа A (h4N2) и A (h2N1), выделенных во всем мире. J. Infect. Дис. 196 , 249–257 (2007).

    CAS Google ученый

  • 180.

    Губарева Л.V. et al. Комплексная оценка лекарственной чувствительности вируса пандемического гриппа A (h2N1) 2009 г. in vitro. Антивирь. Ther 15 , 1151–1159 (2010).

    CAS Google ученый

  • 181.

    Meijer, A. et al. Устойчивый к осельтамивиру вирус гриппа A (h2N1), Европа, сезон 2007–2008 гг. Emerg. Заразить. Дис. 15 , 552–560 (2009).

    PubMed PubMed Central Google ученый

  • 182.

    Блум, Дж. Д., Гонг, Л. И. и Балтимор, Д. Разрешительные вторичные мутации делают возможной эволюцию устойчивости к осельтамивиру гриппа. Science 328, 1272–1275.

  • 183.

    Abed, Y., Pizzorno, A., Bouhy, X. & Boivin, G. Роль разрешающих мутаций нейраминидазы в вирусах гриппа A / Brisbane / 59/2007-подобных (h2N1). PLOS Pathog. 7 , e1002431 (2011).

    Google ученый

  • 184.

    Окомо-Адхиамбо, М.и другие. Устойчивые к осельтамивиру вирусы гриппа A (h2N1) pdm09, США, 2013–2014 гг. Emerg. Заразить. Дис. 21 , 136–141 (2015).

    CAS PubMed PubMed Central Google ученый

  • 185.

    Operario, D. J., Moser, M. J. и St George, K. Высокочувствительное и количественное определение мутации устойчивости к осельтамивиру h374Y в сезонном вирусе гриппа A / h2N1. J. Clin. Microbiol. 48 , 3517–3524 (2010).

    CAS PubMed PubMed Central Google ученый

  • 186.

    Memoli, M. J., Hrabal, R. J., Hassantoufighi, A., Eichelberger, M. C. & Taubenberger, J. K. Быстрый отбор пандемического вируса h2N1, устойчивого к осельтамивиру и перамивиру, во время терапии у 2-х хозяев с ослабленным иммунитетом. Clin. Заразить. Дис. 50 , 1252–1255 (2010).

    CAS PubMed PubMed Central Google ученый

  • 187.

    Whitley, R.J. et al. Глобальная оценка устойчивости к ингибиторам нейраминидазы, 2008-2011 гг .: Информационное исследование устойчивости к гриппу (IRIS). Clin. Заразить. Дис. 56 , 1197–1205 (2013).

    CAS Google ученый

  • 188.

    Butler, J. et al. Оценка преимущества пригодности, обеспечиваемого пермиссивными мутациями нейраминидазы в недавно появившихся устойчивых к осельтамивиру вирусах гриппа A (h2N1) pdm09. PLOS Pathog. 10 , e1004065 (2014).

    Google ученый

  • 189.

    Meijer, A. et al. Глобальная обновленная информация о чувствительности вирусов гриппа человека к ингибиторам нейраминидазы, 2012–2013 гг. Antiviral Res. 110 , 31–41 (2014).

    CAS Google ученый

  • 190.

    Ямашита, М. Ланинамивир и его пролекарство, CS-8958: ингибиторы нейраминидазы длительного действия для лечения гриппа. Антивирь. Chem. Chemother. 21 , 71–84 (2010).

    CAS Google ученый

  • 191.

    Furuta, Y. et al. Фавипиравир (Т-705), новый ингибитор вирусной РНК-полимеразы. Antiviral Res. 100 , 446–454 (2013).

    CAS Google ученый

  • 192.

    Clark, M. P. et al. Открытие нового, первого в своем классе, перорального биодоступного ингибитора азаиндола (VX-787) гриппа PB2. J. Med. Chem. 57 , 6668–6678 (2014).

    CAS Google ученый

  • 193.

    Portsmouth, S., Kawaguchi, K., Arai, M., Tsuchiya, K. & Uehara, T. Cap-зависимый ингибитор эндонуклеаз S-033188 для лечения гриппа: результаты фазы 3, рандомизированное, двойное слепое, плацебо- и активно-контролируемое исследование с участием здоровых подростков и взрослых с сезонным гриппом. Заражение открытого форума.Дис. 4 , S744 (2017). В данной статье представлены результаты клинических испытаний балоксавира марбоксила, нового препарата от гриппа, одобренного в Японии в 2018 г. .

    Google ученый

  • 194.

    Haffizulla, J. et al. Эффект нитазоксанида у взрослых и подростков с острым неосложненным гриппом: двойное слепое рандомизированное плацебо-контролируемое исследование фазы 2b / 3. Ланцетная инфекция. Дис. 14 , 609–618 (2014).

    CAS PubMed PubMed Central Google ученый

  • 195.

    Beigel, J.H. et al. Иммунная плазма для лечения тяжелого гриппа: открытое многоцентровое рандомизированное исследование фазы 2. Ланцет Респир. Med. 5 , 500–511 (2017).

    PubMed PubMed Central Google ученый

  • 196.

    Hung, I. F. N. et al. Лечение гипериммунным внутривенным иммуноглобулином: многоцентровое двойное слепое рандомизированное контролируемое исследование пациентов с тяжелой инфекцией гриппа A (h2N1) 2009 г. Сундук 144 , 464–473 (2013).

    Google ученый

  • 197.

    Koszalka, P., Tilmanis, D. & Hurt, A.C. Противовирусные препараты от гриппа в настоящее время проходят позднюю фазу клинических испытаний. Influenza Other Respir. Вирусы 11 , 240–246 (2017).

    CAS PubMed PubMed Central Google ученый

  • 198.

    Torner, N. et al. Эффективность нефармацевтических мер в профилактике детского гриппа: исследование случай-контроль. BMC Publ. Здравоохранение 15 , 543 (2015).

    Google ученый

  • 199.

    Halloran, M. E. et al. Моделирование целевого многоуровневого сдерживания пандемии гриппа в США. Proc. Natl Acad. Sci. США 105 , 4639–4644 (2008).

    CAS PubMed Google ученый

  • 200.

    Fiore, A. E. et al. Противовирусные средства для лечения и химиопрофилактики гриппа — рекомендации Консультативного комитета по практике иммунизации (ACIP). MMWR Recomm. Отчет 60 , 1–24 (2011).

    Google ученый

  • 201.

    Уеки Т. Противовирусное лечение пациентов, госпитализированных с пандемическим гриппом A (h2N1) 2009 г. N. Engl. J. Med. 361 , e110 (2009).

    Google ученый

  • 202.

    Stewart, R.J. et al. Назначение противовирусных препаратов против гриппа амбулаторным пациентам с острым респираторным заболеванием и высоким риском гриппозависимых осложнений в течение 5 сезонов гриппа — США, 2011–2016 гг. Clin. Заразить. Дис. 66 , 1035–1041 (2018).

    Google ученый

  • 203.

    Oboho, I. K. et al. Применение осельтамивира среди детей и взрослых, госпитализированных с внебольничной пневмонией. Заражение открытого форума. Дис. 4 , оф. 254 (2017).

    Google ученый

  • 204.

    Coleman, B. L. et al. Тенденции использования противовирусных препаратов у госпитализированных пациентов с лабораторно подтвержденным гриппом до и после пандемии: 2004 / 05-2013 / 14, Торонто, Канада. Antiviral Res. 140 , 158–163 (2017).

    CAS Google ученый

  • 205.

    Hung, I. F. N. et al. Эффективность комбинации кларитромицин-напроксен-озельтамивир в лечении пациентов, госпитализированных с инфекцией гриппа A (h4N2): открытое рандомизированное контролируемое исследование фазы IIb / III. Сундук 151 , 1069–1080 (2017).

    Google ученый

  • 206.

    Симс, Л. Д. Стратегии вмешательства для снижения риска зоонозной инфекции вирусами птичьего гриппа: научная основа, проблемы и пробелы в знаниях. Influenza Other Respir. Вирусы 7 (Приложение 2), 15–25 (2013).

    PubMed PubMed Central Google ученый

  • 207.

    Domenech, J. et al. Опыт вакцинации в странах, эндемически инфицированных высокопатогенным гриппом птиц: перспектива Продовольственной и сельскохозяйственной организации Объединенных Наций. Rev. Sci. Tech. 28 , 293–305 (2009).

    CAS Google ученый

  • 208.

    Ellis, T. M. et al. Использование вакцинации против птичьего гриппа в Гонконге. Dev. Биол. 124 , 133–143 (2006).

    CAS Google ученый

  • 209.

    Leung, Y.H. et al. Птичий грипп и запрет на ночное хранение птицы на рынках живой птицы, Гонконг. Emerg. Заразить. Дис. 18 , 1339–1341 (2012).

    PubMed PubMed Central Google ученый

  • 210.

    Lau, E.H. et al. Влияние вмешательств на изоляцию гриппа A (H9N2) на рынках живой птицы Гонконга, 1999–2005 гг. Emerg. Заразить. Дис. 13 , 1340–1347 (2007).

    Google ученый

  • 211.

    Бао, К. Дж.и другие. Рынки живых животных и инфекция, вызванная вирусом гриппа A (H7N9). N. Engl. J. Med. 368 , 2337–2339 (2013).

    CAS Google ученый

  • 212.

    Chambers, TM, Dubovi, EJ & Donis, RO в Textbook of Influenza 2nd edn (eds Webster, RG, Monto, AS, Braciale, TJ & Lamb, RA) (Blackwell Science, Oxford, 2013 ).

  • 213.

    Никол, К. Л., Д’Хейли, С.Дж., Гринберг, М. Э. и Элингер, Э. Бремя гриппоподобных заболеваний и эффективность вакцинации против гриппа среди работающих взрослых в возрасте 50–64 лет. Clin. Заразить. Дис. 48 , 292–298 (2009).

    Google ученый

  • 214.

    Gozalo, P. L., Pop-Vicas, A., Feng, Z., Gravenstein, S. & Mor, V. Влияние гриппа на функциональное снижение. J. Am. Гериатр. Soc. 60 , 1260–1267 (2012).

    PubMed PubMed Central Google ученый

  • 215.

    Molinari, N.A. et al. Ежегодное воздействие сезонного гриппа в США: измерение бремени болезней и затрат. Вакцина 25 , 5086–5096 (2007).

    Google ученый

  • 216.

    Релло, Дж. И Поп-Викас, А. Клинический обзор: первичная вирусная пневмония гриппа. Crit. Уход 13 , 235 (2009).

    PubMed PubMed Central Google ученый

  • 217.

    Моренс, Д. М., Таубенбергер, Дж. К. и Фаучи, А. С. Преобладающая роль бактериальной пневмонии как причины смерти при пандемическом гриппе: последствия для готовности к пандемическому гриппу. J. Infect. Дис. 198 , 962–970 (2008).

    PubMed PubMed Central Google ученый

  • 9002 218.

    Чиен, Ю. В., Клугман, К. П. и Моренс, Д. М. Бактериальные патогены и смерть во время пандемии гриппа 1918 года. N. Engl. J. Med. 361 , 2582–2583 (2009).

    Google ученый

  • 219.

    Моррис Д. Э., Клири Д. В. и Кларк С. С. Вторичные бактериальные инфекции, связанные с пандемиями гриппа. Фронт. Microbiol. 8 , 1041 (2017).

    PubMed PubMed Central Google ученый

  • 220.

    Таубенбергер, Дж. К. и Моренс, Д. М. Патология вирусных инфекций гриппа. Annu. Преподобный Патол. 3 , 499–522 (2008).

    CAS PubMed PubMed Central Google ученый

  • 221.

    Agyeman, P., Duppenthaler, A., Heininger, U. & Aebi, C. Миозит, связанный с гриппом, у детей. Инфекция 32 , 199–203 (2004).

    CAS Google ученый

  • 222.

    MacDonald, K. L. et al. Синдром токсического шока. Недавно признанное осложнение гриппа и гриппоподобного заболевания. JAMA 257 , 1053–1058 (1987).

    CAS Google ученый

  • 223.

    Steininger, C. et al. Острая энцефалопатия, связанная с инфекцией вируса гриппа А. Clin. Заразить. Дис. 36 , 567–574 (2003).

    PubMed PubMed Central Google ученый

  • 224.

    Дурмашкин Р. Р. Чем была вызвана эпидемия летаргического энцефалита в 1918–1930 гг.? J. R. Soc. Med. 90 , 515–520 (1997).

    CAS Google ученый

  • 225.

    Zost, S.J. et al. Современные вирусы гриппа h4N2 имеют сайт гликозилирования, который изменяет связывание антител, вызванных штаммами вакцины, адаптированными к яйцам. Proc. Natl Acad. Sci. США 114 , 12578–12583 (2017).

    CAS PubMed Google ученый

  • 226.

    Хайден, Ф. Г. Экспериментальный человеческий грипп: наблюдения на основе исследований противовирусных препаратов гриппа. Антивирь. Ther. 17 , 133–141 (2012).

    CAS Google ученый

  • 227.

    Erbelding, E.J. et al. Универсальная вакцина против гриппа: стратегический план Национального института аллергии и инфекционных заболеваний. J. Infect. Дис. https://doi.org/10.1093/infdis/jiy103 (2018).

  • 228.

    Freidl, G. S. et al. Грипп на стыке животных и человека: обзор литературы по вирусологическим доказательствам заражения человека вирусами свиного или птичьего гриппа, отличными от A (H5N1). евро Surveill. 19 https://www.eurosurveillance.org/images/dynamic/EE/V19N18/art20793.pdf (2014 г.).

  • 229.

    Abdelwhab el, S.M., Veits, J. & Mettenleiter, T.C. Генетические изменения, сопровождавшие сдвиг низкопатогенных вирусов птичьего гриппа в сторону более высокой патогенности у домашней птицы. Вирулентность 4 , 441–452 (2013).

    Google ученый

  • 230.

    Всемирная организация здравоохранения. Общее количество подтвержденных случаев заболевания людей птичьим гриппом A (H5N1), зарегистрированных в ВОЗ, 2003–2017 гг. ВОЗ http://www.who.int/influenza/human_animal_interface/2017_12_07_tableH5N1.pdf (2017).

  • 231.

    Pantin-Jackwood, M.J. et al. Роль домашней птицы в распространении нового вируса гриппа H7N9 в Китае. J. Virol. 88 , 5381–5390 (2014).

    PubMed PubMed Central Google ученый

  • 232.

    Всемирная организация здравоохранения. Заражение человека вирусом птичьего гриппа A (H7N9) — Китай. ВОЗ http://www.who.int/csr/don/26-october-2017-ah7n9-china/en/ (2017).

  • 233.

    Imai, M. et al. Высокопатогенный вирус птичьего гриппа H7N9, выделенный от человека, является смертельным для некоторых хорьков, инфицированных воздушно-капельным путем. Cell Host Microbe 22 , 615–626 (2017).

    CAS PubMed PubMed Central Google ученый

  • 234.

    Li, C. et al. Эволюция вирусов гриппа H9N2 от домашней птицы в материковом Китае. Вирусология 340 , 70–83 (2005).

    CAS Google ученый

  • 235.

    Lam, T. T. et al. Происхождение и источник вирусов гриппа H7N9, вызывающих инфицирование людей в Китае. Природа 502 , 241–244 (2013).

    CAS PubMed PubMed Central Google ученый

  • 236.

    Палезе, П., Тумпи, Т. М. и Гарсия-Састре, А. Чему мы можем научиться, реконструируя вымерший вирус пандемического гриппа 1918 года? Иммунитет 24 , 121–124 (2006).

    CAS Google ученый

  • 237.

    Matthey, S.и другие. Быстрое обнаружение респираторных вирусов путем культивирования из оболочки флакона и прямого окрашивания с использованием объединенных и индивидуальных моноклональных антител. J. Clin. Microbiol. 30 , 540–544 (1992).

    CAS PubMed PubMed Central Google ученый

  • 238.

    Loeffelholz, M. J. et al. Сравнение респираторной панели FilmArray и анализов ПЦР в реальном времени Prodesse для обнаружения респираторных патогенов. Дж.Clin. Microbiol. 49 , 4083–4088 (2011).

    CAS PubMed PubMed Central Google ученый

  • 239.

    Teo, J. et al. VereFlu: интегрированный мультиплексный RT-PCR и анализ на микрочипах для быстрого обнаружения и идентификации вирусов гриппа A и B человека с использованием технологии «лаборатория на чипе». Arch. Virol. 156 , 1371–1378 (2011).

    CAS PubMed PubMed Central Google ученый

  • 240.

    Ким Д. К. и Пудель Б. Инструменты для обнаружения вируса гриппа. Yonsei Med. J. 54 , 560–566 (2013).

    CAS PubMed PubMed Central Google ученый

  • 241.

    Hurt, A.C., Alexander, R., Hibbert, J., Deed, N. & Barr, I.G. Проведение шести экспресс-тестов на грипп при обнаружении гриппа человека в клинических образцах. J. Clin. Virol. 39 , 132–135 (2007).

    CAS Google ученый

  • Границы | Самостоятельная сборка пептидной нановакцины на основе M2e обеспечивает широкую защиту от вирусов гриппа

    Введение

    Грипп остается серьезной угрозой для здоровья населения, несмотря на то, что его изучают более 100 лет с 1918 года.Эпидемии сезонного гриппа вызывают около 3-5 миллионов случаев тяжелых заболеваний и от 290 000 до 650 000 смертей во всем мире ежегодно (Всемирная организация здравоохранения [ВОЗ], 2018). Современные вакцины против сезонного гриппа, включая инактивированные и живые аттенуированные вакцины против гриппа, обеспечивают защиту путем индукции нейтрализующих антител против белка гемагглютинина гриппа (HA) (Caton et al., 1982). Вирусы могут ускользать из-под защиты за счет быстрого антигенного дрейфа из-за накопления мутаций на сайте связывания антител белка НА и делают вакцину неэффективной (Илюшина и др., 2019). Антигенные компоненты вакцины против гриппа необходимо обновлять каждый год, чтобы не отставать от эпидемических вирусов (Krammer and Palese, 2015). Компоненты вирусного антигена в сезонных вакцинах выбираются на основе данных эпиднадзора за гриппом и прогноза эпидемии (Auladell et al., 2019). Эффективность вакцины против сезонного гриппа определяется сходством штаммов вакцины и циркулирующих вирусов (Estrada and Schultz-Cherry, 2019). Вакцина может быть не в состоянии обеспечить достаточную защиту при несовпадении с циркулирующими штаммами (Belongia et al., 2016), что привело к вспышке гриппозной инфекции. Было высказано предположение, что неэффективность вакцины против сезонного гриппа вызвала значительную заболеваемость и смертность во всем мире в течение сезона гриппа 2017–2018 гг. (Barr et al., 2018). Кроме того, появление высокопатогенных вирусов птичьего гриппа, в том числе вирусов H5N1 и H7N9, ставит под сомнение текущую стратегию вакцины против гриппа за счет появления новых штаммов гриппа. Вирусы птичьего гриппа могут вызвать всемирную пандемию гриппа, если они эффективно передаются от человека к человеку.Существующая вакцина против сезонного гриппа не может обеспечить эффективную защиту от вирусов птичьего гриппа (Stephenson et al., 2004; Zhou et al., 2013). Настоятельно необходимо улучшить стратегию вакцинации против гриппа и разработать универсальные вакцины против гриппа, которые могли бы обеспечить перекрестную защиту от различных штаммов гриппа.

    Эктодомен белка гриппа M2 (M2e) является многообещающей мишенью для разработки универсальных противогриппозных вакцин (Estrada and Schultz-Cherry, 2019). M2e содержит 23 аминокислоты и очень консервативен для многих штаммов гриппа.Пассивное введение M2e-специфических моноклональных антител могло обеспечить защиту от заражения гриппом экспериментальных животных (Zebedee and Lamb, 1988; Liu et al., 2004). Человеческое моноклональное антитело, специфичное к M2e, может уменьшить клинические симптомы и вирусную нагрузку при введении добровольцам, зараженным эпидемическими штаммами гриппа (Ramos et al., 2015). Вызванный M2e защитный иммунитет был достигнут у животных путем вакцинации различными типами противогриппозных вакцин на основе M2e, включая конъюгаты пептида M2e, рекомбинантные слитые белки M2e, ДНК-вакцины на основе M2e и другие.Несколько вакцин против гриппа M2e были оценены в ходе клинических испытаний фазы I / II, однако вакцины против гриппа на основе M2e, доступной для клинического использования, еще не было (Kolpe et al., 2017).

    Из-за низкой иммуногенности чистого белка M2e в большинстве вакцин на основе M2e использовались белки-носители, химически или генетически слитые с M2e, для повышения иммуногенности вакцин M2e (Estrada and Schultz-Cherry, 2019; Mezhenskaya et al., 2019). Эти вакцины не только успешно вызывали M2e-специфические иммунные ответы, но также вызывали сильные иммунные ответы на белки-носители, которые могут вызывать неожиданные побочные эффекты при использовании у людей.Например, вакцина против гриппа VAX102 на основе M2e, которая представляет собой рекомбинантный слитый белок M2e-флагеллин, вызвала сильные местные и системные побочные реакции при введении людям в высоких дозах (Turley et al., 2011). Сильный носитель-специфический иммунный ответ также может вызывать индуцированное носителем эпитопное подавление и, таким образом, ослаблять M2e-специфический иммунный ответ (Heinen et al., 2002). Другая вакцина на основе M2e, ACAM-FLU-A, которая состоит из трех тандемных копий эпитопа M2e, слитого с коровым белком гепатита B, индуцировала M2e-специфические антитела в фазе I клинических испытаний (ClinicalTrials.gov Идентификационный номер NCT00819013). Однако титры M2e-специфических антител быстро снижались у добровольцев (Kolpe et al., 2017). Хотя подробные результаты и лежащие в основе механизмы еще не опубликованы, мы предположили, что снижение M2e-специфических антител может быть связано с сильной иммуногенностью корового белка HBV, поскольку индуцированная носителем эпитопная супрессия ранее наблюдалась в вакцинах, конъюгированных с эпитопом (Jegerlehner et al. др., 2010).

    В этом исследовании мы провели исследование, подтверждающее концепцию, и оценили безопасность и эффективность нового метода повышения иммуногенности эпитопа M2e.Мы синтезировали пептид, состоящий из эпитопа M2e, связанного с фибриллированным пептидом Q11. Пептид Q11 может самособираться в нановолокно в условиях физиологического pH и действовать как иммунный адъювант для повышения иммуногенности связанных антигенных эпитопов (Rudra et al., 2010, 2012a, b). Мы подтвердили, что пептид M2e-Q11 может самособираться в наночастицы и вызывать ответ антител, специфичный для M2e, у мышей без дополнительного адъюванта. Более того, наночастицы M2e-Q11 не вызывали иммунных ответов против фибриллизующего пептида Q11, снижая потенциальные побочные эффекты, которые могли быть вызваны иммуногенностью носителя вакцины.Вакцинация наночастицами M2e-Q11 также была способна защитить мышей от смертельного заражения различными подтипами гриппа, предполагая, что самосборка наночастиц M2e-Q11 является многообещающей стратегией для разработки универсальной вакцины против гриппа.

    Материалы и методы

    Пептиды и вирус

    Пептиды синтезированы твердофазным методом в Synpeptide Co. (Шанхай, Китай). Пептид M2e, N-SLLTEVETPIRN EWGCRCNDSSD, представляет собой консервативный домен M2e вируса гриппа А.Пептид Q11, N-QQKFQFQFEQQ, представляет собой пептид самосборки, который образует фибриллы в условиях физиологического pH. Пептид M2e-Q11, N-SLLTEVETPIRNEW GCRCNDSSDSGSGQQKFQFQFEQQ, представляет собой пептид M2e, ковалентно связанный с пептидом Q11 с помощью спейсерной последовательности GSGS. Пептид M2e птиц, N-SLLTEVETPTRTGWECNCSGSSD, представляет собой пептид, содержащий последовательность M2e из вируса птичьего H7N9. Пептид M2e свиньи, N-SLLTEVETPTRSEWECRCSGSSD, представляет собой пептид, содержащий последовательность M2e из вируса гриппа h2N1 свиньи. Все пептиды очищали с помощью ВЭЖХ и анализировали масс-спектрометрией.Чистота пептидов была выше 90%. Исходный раствор пептидов готовили в концентрации 8 мМ в дистиллированной воде и хранили при -20 ° C.

    Вирусы гриппа, адаптированные к мышам, A / Purto Rico / 8/34 (PR8, h2N1) и вирус птичьего гриппа A / Shanghai / 4664T / 2013 (H7N9) размножали в клетках MDCK. TCID50 и чумообразующие единицы (БОЕ) вирусов оценивали на монослое клеток MDCK. Летальные дозы вирусов титровали на мышах и рассчитывали по методу Рида – Мюнха. Эксперименты с участием вируса птичьего гриппа H7N9 проводились в лаборатории ABSL-3 в центре общественного здравоохранения Шанхая и в соответствии с протоколами, утвержденными институциональным комитетом по биобезопасности.

    Определение размера наночастиц

    Пептиды M2e-Q11, Q11 и M2e разбавляли от исходной концентрации (8 мМ) до 1 мМ с помощью PBS и инкубировали при комнатной температуре в течение 4 часов, чтобы обеспечить фибрилляцию. Растворы дополнительно инкубировали в течение ночи при 4 ° C перед разбавлением PBS до конечной концентрации 0,25 мМ. Растворы пептидов адсорбировали на покрытых углем медных сетках размером 200 меш, отрицательно окрашивали 2% уранилацетатом и отображали с помощью просвечивающего электронного микроскопа FEI Tecnai G2 Spirit.Распределение наночастиц по размерам анализировали с помощью динамического светорассеяния с помощью Zetasizer ZEN3600 (Malvern Panalytical Ltd.).

    Иммунизация

    Самок мышей Balb / C (возраст 6-8 недель) разделили на четыре группы и внутрибрюшинно иммунизировали 10 нМ пептида M2e-Q11, пептида Q11 и пептида M2e соответственно. Перед иммунизацией пептиды M2e-Q11 и Q11 разводили в стерильном растворе PBS до концентрации 2 мМ и инкубировали при комнатной температуре для фибрилизации.Пептид M2e разбавляли до 200 мкМ и смешивали 1: 1 с алюминиевым адъювантом (InvivoGen 5200). Мышей иммунизировали внутрибрюшинно 10 нМ наночастицами или пептидом. Повышающую иммунизацию проводили той же формулой вакцины через 2 недели после первой иммунизации. Сыворотку собирали через 14 дней после ревакцинации. Сыворотку мышей, иммунизированных PBS, собирали в качестве отрицательного контроля.

    Обнаружение антител

    M2e и Q11-специфические антитела измеряли с помощью иммуноферментного анализа (ELISA).Вкратце, планшеты Nunc-Immuno (Nunc 442404) покрывали 50 мкл разведенного PBS пептида M2e человека, пептида M2e птицы или пептида M2e свиньи, 5 мкг / мл, при 4 ° C в течение ночи. Неспецифическое связывание блокировали 200 мкл 0,25% желатина в растворе PBST (0,5% Tween-20 в PBS). 50 мкл серийно разведенных сывороток добавляли в каждую лунку и инкубировали при 37 ° C в течение полутора часов. После обширной промывки раствором PBST связывающие антитела выявляли с помощью меченных HRP козьих антител против IgG мыши (BioLegend B243363) и субстрата TMB (Biosharp 0759) в соответствии с инструкциями производителя.

    Изотипы M2e-специфических антител определяли с помощью ELISA с реагентами для изотипирования моноклональных антител мыши (Sigma, ISO-2) в соответствии с инструкциями производителя.

    Проблема с вирусом гриппа

    Мышей анестезировали изофлураном (Baxter CN2L9100) и интраназально заражали 5 LD50 адаптированного к мыши вируса гриппа PR8 (5 × 10 3 TCID 50 ) и птичьего H7N9 (1,75 × 10 4 TCID 50 ). , Через 3 недели после последней иммунизации.Массу тела и выживаемость мышей контролировали ежедневно в течение 2 недель после заражения.

    Определение титров легочного вируса методом RT-qPCR

    На 14-й день контрольного заражения выживших мышей подвергали глубокой анестезии и декапитировали, а их легочные ткани отбирали для экстракции РНК (Tiangen DP431). Праймеры и зонд, нацеленные на ген M вируса гриппа и β-актин мыши, использовали для RT-qPCR со следующими последовательностями: 1012FluA-Fv1 GGARTGGMTAAAGACAAGAC CAATC; 1012FluA-Rv1 GGCRTTYTGGACAAASCGTCTAC; 1012FluA-Pv1 5 ‘ROX-AGTCCTCGCTCACTGGGCACGGT-3’ BHQ2; b-актин вперед GAGATTACTGCTCTGGCTCCTA; b-актин обратный GGACTCATCGTACTCCTGCTTG; b-актин P 5’VIC-CCTGAGCGCAAGTACTCTGTGTGGATC-3 ‘BHQ.RT-qPCR выполняли с использованием системы обнаружения ABI 7500 в One Step PrimeScript TM RT-PCR Kit (Perfect Real Time) (Takara RR064A) при следующих условиях: 42 ° C в течение 10 минут, 95 ° C в течение 2 минут, и 40 циклов 95 ° C в течение 10 с и 60 ° C в течение 1 мин. Значения порогового цикла (CT), представляющие вирусные геномы, анализировали с помощью программного обеспечения CFX Manager, и данные были показаны в виде эквивалентов генома (GEq) на микролитр.

    Статистический анализ

    Титры антител, титры вирусов и массы тела между группами сравнивали с помощью одно- или двухфакторного дисперсионного анализа.Выживаемость сравнивали с помощью лог-рангового теста. P -значение менее 0,05 считалось значимым. Весь статистический анализ был выполнен с помощью GraphPad Prism версии 7.00 (GraphPad Software, Сан-Диего, Калифорния, США).

    Результаты

    Пептид M2e-Q11, собранный в наноструктуру в растворе PBS

    Эпитоп M2e гриппа состоит всего из 23 аминокислот и является плохо иммуногенным при введении отдельно. Ранее мы сообщали, что 23-мерный пептид M2e может частично самособираться в полимер за счет внутрипептидных дисульфидных связей и индуцировать M2e-специфический иммунный ответ с адъювантами у экспериментальных мышей (Wu et al., 2007; Zou et al., 2017). В этом исследовании мы синтезировали 38-мерный пептид M2e-Q11, SLLT EVETPIRNEWGCRCNDSSDSGSGQQKFQFQFEQQ, состоящий из эпитопа M2e человеческого гриппа, связанного с доменом Q11 фибриллизующего пептида (QQKFQFQFEQQ) с четырьмя аминокислотами Gly-Gly-Ser в качестве спейсера. Пептид Q11 использовали для ускорения сборки пептида в наночастицу, поскольку он успешно применялся в качестве иммунного адъюванта для повышения иммуногенности эпитопов овальбумина и малярии. Пептиды M2e и Q11 также были синтезированы в качестве контролей.Все пептиды растворяли в воде при концентрации 10 мг / мл без преципитации. При разбавлении в растворе PBS пептиды M2e-Q11 и Q11 собирались в различные наноструктуры, которые наблюдались с помощью ПЭМ и показаны на рисунке 1. Пептид Q11 самособирался в волокнистую структуру, как описано ранее (Rudra et al., 2010). Однако пептид M2e-Q11 не образовывал длинные нановолокна, как пептид Q11, а вместо этого собирался в разветвленные нано-палочки. Разветвленные наностики имели длину около 100 нм и ширину 15 нм.Несмотря на то, что пептид M2e мог образовывать пептидный полимер за счет внутрипептидного дисульфидного взаимодействия, он не формировал детектируемую наноструктуру при ПЭМ. Распределение наночастиц по размерам было проанализировано с помощью анализа динамического светорассеяния и показано на рисунке 2А. Средний гидродинамический диаметр составлял 776 ± 147 нм для наночастиц пептида Q11 и 238 ± 25 нм для наночастиц пептида M2e-Q11.

    Рисунок 1. Наноструктура самосборных пептидов с помощью просвечивающего электронного микроскопа (ТЕМ).Пептиды разбавляли раствором PBS и инкубировали в течение ночи для сборки в наноструктуру. Растворы пептидов адсорбировались на покрытых углеродом медных сетках, окрашивались уранилацетатом и визуализировались с помощью ТЕМ FEI Tecnai G2 Spirit. (A) пептид M2e; (B) пептид Q11; (C) пептид M2e-Q11.

    Рис. 2. Характеристика наночастиц M2e-Q11. (A) Распределение по размерам наночастиц Q11, пептида M2e-Q11 и пептида M2e. (B) Реактивность защитного mAb 8C6 против M2e по отношению к самосборке наночастиц. Планшеты были покрыты пептидом или образованными пептидом наночастицами в различных концентрациях. Связывание 8C6 с пептидом или наночастицами измеряли с помощью ELISA. Каждый образец тестировали в трех экземплярах, и показаны средние значения оптической плотности при 450 нм (A450).

    Затем мы использовали M2e-специфическое моноклональное антитело 8C6, чтобы оценить, правильно ли был представлен эпитоп M2e на наночастицах M2e-Q11.8C6 был изолирован от M2e-иммунизированных мышей и может защищать от летальной дозы заражения гриппом при пассивном введении мышам (Liu et al., 2004). Взаимодействие mAb 8C6 с наночастицами M2e-Q11, Q11 и пептидами M2e оценивали с помощью ELISA. Как показано на рисунке 2, 8C6 эффективно распознает наночастицы M2e-Q11 и пептид M2e, но не может связывать нановолокна Q11. Эти результаты свидетельствуют о том, что защитный эпитоп M2e правильно представлен на наночастицах M2e-Q11 и доступен для защитных антител.

    Антитела, индуцированные наночастицами M2e-Q11, распознающие эпитопы M2e вирусов гриппа человека, свиней и птиц

    Мы оценили, способны ли наночастицы M2e-Q11 вызывать M2e-специфический иммунный ответ. Мышей Balb / c иммунизировали внутрибрюшинно наночастицами M2e-Q11 или нановолокном Q11 без адъювантов. Мышей также иммунизировали внутрибрюшинно пептидом M2e с алюминиевым адъювантом в качестве положительного контроля. Сыворотку мышей собирали через 14 дней после повторной иммунизации.M2e-специфические и Q11-специфические антитела оценивали с помощью ELISA. Как показано на рисунке 3A, M2e-специфические антитела были индуцированы у мышей, иммунизированных наночастицами M2e-Q11. Титры M2e-специфических антител у мышей, иммунизированных наночастицами M2e-Q11, были примерно 1: 1600, что было ниже, чем у мышей, иммунизированных пептидом алюминиевый адъювант-M2e. Как и ожидалось, M2e-специфические антитела не были обнаружены у мышей, иммунизированных нановолокном Q11 или раствором PBS. В соответствии с предыдущими сообщениями, ни наночастицы M2e-Q11, ни нановолокно Q11 не смогли индуцировать Q11-специфические антитела (рис. 3B).По сравнению с пептидом алюминий-адъювант-M2e, который индуцировал множественные изотипы M2e-специфических антител (рис. 3C), наночастицы M2e-Q11 в основном индуцировали изотипы IgG1 и IgM M2e-специфических антител (рис. 3D).

    Фигура 3. M2e-специфические и Q11-специфические антитела определяли с помощью ELISA. Мышей иммунизировали наночастицами M2e-Q11, пептидом M2e с алюминиевым адъювантом, нановолокном Q11, пептидом M2e или только PBS. Сыворотку собирали через 14 дней после двукратной иммунизации. Антитела, специфичные к пептиду M2e (A) человека гриппа или пептиду Q11 (B) , тестировали с помощью ELISA.Показаны средние значения поглощения при 450 нм (A450) восьми мышей в каждой группе. Показаны изотипы M2e-специфических антител у мышей, иммунизированных алюминиевым адъювантом пептида M2e (C) и наночастиц пептида M2e-Q11 (D) .

    Мы также оценили, могут ли антитела, индуцированные наночастицами M2e-Q11, перекрестно реагировать с белками M2e других подтипов гриппа. Мы синтезировали пептиды M2e в соответствии с последовательностями M2e из вирусов гриппа свиней h2N1 и H7N9 и протестировали перекрестную реактивность антисывороток к этим пептидам с помощью ELISA.Существует шесть аминокислотных замен среди последовательностей M2e человека, h2N1 свиньи и H7N9 M2e птиц (рис. 4A). Как показано на фиг. 4B – D, сыворотки от мышей, вакцинированных M2e-Q11, эффективно связываются с пептидами M2e из вируса гриппа H7N9 птиц и вируса гриппа h2N1 свиней, несмотря на то, что в последовательностях M2e человека было шесть аминокислотных замен по сравнению с последовательностями M2e свиней и птиц. Титры антител от мышей, иммунизированных M2e-Q11, составляли около 1024 против M2e птиц и свиней, что было аналогично титрам против гриппа M2e человека.Мы наблюдали, что вакцина с алюминиевым адъювантом и пептидом M2e также индуцировала антитела против пептида M2e птиц и свиней, но титры антител против пептидов M2e свиного и птичьего гриппа были примерно в четыре раза ниже, чем таковые против пептида M2e человека.

    Рисунок 4. Оценка антител, перекрестно реагирующих с h2N1 свиньи и пептидом M2e H7N9 птицы. (A) Выравнивание последовательностей гриппа человека, свиного h2N1 и птичьего H7N9 M2e. Аминокислотные замены выделены жирным шрифтом.Показаны титры антител, специфичные для человеческого M2e (B) , свиного h2N1 гриппа M2e (C) и птичьего H7N9 M2e (D) .

    Вакцинация мышей, защищенных наночастицами M2e-Q11, против вируса h2N1 и заражения птичьим гриппом H7N9

    Мы оценили защитную эффективность вакцинации наночастицами M2e-Q11 против гомологичного вируса гриппа у мышей. После первичной иммунизации мышей заражали летальной дозой адаптированного к мышам вируса гриппа PR8 h2N1.У всех мышей через 3 дня после заражения наблюдались признаки гриппа, такие как сбивание в кучу, взъерошенный мех. Как показано на фиг. 5A, семь из восьми мышей в группе, иммунизированной Q11, погибли после заражения вирусом гриппа. Среднее время выживания в этой группе составляет 8 дней. Напротив, пять из восьми мышей, вакцинированных M2e-Q11, выжили после заражения гриппом PR8. Выживаемость значительно выше, чем у мышей, иммунизированных нановолокном Q11 ( P = 0,0222, лог-ранговый тест). Мыши, иммунизированные M2e-Q11, также продемонстрировали меньшую потерю массы тела, чем мыши, иммунизированные нановолокном Q11 (фиг. 5B, P = 0.0249, двусторонний дисперсионный анализ). В качестве положительного контроля шесть из восьми мышей, иммунизированных пептидом M2e с алюминиевым адъювантом, выжили после заражения гриппом. Однако ни показатели выживаемости, ни изменение массы тела существенно не различаются между мышами, иммунизированными пептидом M2e с алюминиевым адъювантом и наночастицами M2e-Q11. Титры легочных вирусов у выживших из группы, иммунизированной M2e-Q11, были ниже, чем титры пептида M2e с алюминиевым адъювантом, но разница не была значимой (рис. 5C, p = 0,4875, t -тест).

    Рис. 5. Вакцинация наночастицами M2e-Q11 обеспечивала защиту от вируса PR8 и заражения птичьим гриппом H7N9. (A) Мышей иммунизировали наночастицей M2e-Q11, пептидом M2e с алюминиевым адъювантом или нановолокном Q11 и заражали 5 LD 50 (5 × 10 3 TCID50) адаптированного к мышам вируса гриппа PR8 (A / Purto Rico / 8/34, h2N1). Кривые выживаемости анализировали методами Каплана – Мейера ( N = 8 в каждой группе). (B) Показан средний вес восьми мышей, зараженных вирусом гриппа PR8, в каждой группе.4TCID50) вируса птичьего гриппа H7N9 (A / Shanghai / 4664T / 2013). Кривые выживаемости анализировали методами Каплана – Мейера ( N = 8 в каждой группе). (E) Показан средний вес восьми мышей, зараженных вирусом птичьего гриппа H7N9, в каждой группе. (F) Показаны копий вирусной РНК в тканях легких выживших в каждой группе, зараженной вирусом гриппа H7N9.

    Затем мы оценили, может ли наночастица M2e-Q11 обеспечивать перекрестную защиту от гетерологичных вирусов гриппа.После первичной иммунизации мышей заражали высокопатогенным вирусом птичьего гриппа H7N9. Как показано на фиг. 5D, пять из восьми мышей в группе, иммунизированной Q11, умерли от инфекции птичьего гриппа H7N9. Среднее время выживания в этой группе составляло 12 дней. Однако все мыши, иммунизированные M2e-Q11 или пептидом M2e с алюминиевым адъювантом, выжили после заражения птичьим гриппом H7N9. Показатели выживаемости в этих двух группах были значительно выше, чем в группе, иммунизированной Q11 ( P = 0.0004, лог-ранговый тест). Мыши, иммунизированные наночастицами M2e-Q11 и пептидом M2e с алюминиевым адъювантом, также показали потерю массы тела, но значительно меньшую, чем мыши, иммунизированные нановолокном Q11 (рис. 5E, P <0,0001, двухфакторный дисперсионный анализ ANOVA). Однако не наблюдалось значительной разницы в титрах легочных вирусов среди выживших из трех групп (фигура 5F, P = 0,6505, однофакторный дисперсионный анализ ANOVA).

    Обсуждение

    Применение нанотехнологий — многообещающая стратегия для разработки эффективных вакцин против инфекционных вирусов (Chen et al., 2013). Для разработки противогриппозных вакцин были исследованы многочисленные платформы нанотехнологий, включая полимерные наночастицы, белки и пептиды самосборки, наночастицы неорганического золота (Al-Halifa et al., 2019). Здесь мы использовали фибриллирующий пептид Q11 для создания вакцины против гриппа на основе наночастиц M2e. Пептид M2e-Q11 успешно самособирается в наночастицы в физиологическом солевом растворе и индуцирует антительный ответ против различных подтипов пептидов M2e гриппа у экспериментальных мышей.Эта самособирающаяся нановакцина M2e также защищала мышей от множества подтипов вирусов гриппа, включая вирусы гриппа как группы 1 (адаптированный для мыши h2N1 PR8), так и группы 2 (птичий грипп H7N9).

    Одним из преимуществ использования самособирающейся пептидной вакцины перед пептидными вакцинами на белковой основе является низкая иммуногенность носителей. Самособирающиеся пептиды обычно не вызывают иммунных ответов (Chen et al., 2013). В нашем исследовании ни M2e-Q11, ни наночастицы Q11 не индуцировали выявляемые Q11-специфические антитела у мышей после первичной иммунизации.Низкая иммуногенность носителей позволяет избежать потенциальных побочных эффектов или подавления эпитопии, вызванного носителем, при клиническом применении. Еще одно преимущество нановакцин на основе пептидов состоит в том, что пептиды можно синтезировать с высокой чистотой с помощью существующего метода твердофазного синтеза пептидов без последующей очистки (Rudra et al., 2010). Это не только снижает стоимость производства, но также снижает риск потенциальных побочных эффектов, вызванных загрязнением бактериальным эндотоксином или компонентами клеток млекопитающих во время экспрессии белка.

    В исследовании, описанном в этой статье, мы использовали самособирающийся домен Q11 для стимулирования образования наночастиц, поскольку он был успешно использован для повышения иммуногенности нескольких антигенных эпитопов (Rudra et al., 2010, 2012a, b). Другие самособирающиеся пептиды также могут обладать аналогичной адъювантной активностью. Однако способность образовывать наночастицы самособирающихся пептидов должна быть оценена при связывании с антигенными эпитопами. Конъюгаты Q11 успешно самоорганизуются в нановолокно и индуцируют сильные гуморальные и Т-клеточные иммунные ответы при включении с короткими антигенными эпитопами, такими как эпитопы Т-клеток яиц, малярии и гриппа (Rudra et al., 2010, 2012а, б; Si et al., 2018). Хотя конъюгат M2e-Q11 в этом исследовании не смог сформировать нановолокна, вместо этого он собрал короткие нанопалочки. Эпитоп M2e состоит из 23 аминокислот, что длиннее, чем эпитопы Т-клеток яйцеклеток, малярии и гриппа (Меженская и др., 2019). Структура пептида M2e может препятствовать образованию Q11 длинных нановолокон. В предыдущем сообщении конъюгат пептида Q11, связанный с 29-мерным В-клеточным эпитопом J14 из стрептококка, не смог сформировать наноструктуру и не вызывал специфических иммунных ответов (Azmi et al., 2014). Эти результаты показали, что адъювантная активность фибриллированного пептида зависит от его способности образовывать наночастицы. Как различия в размере и структуре наночастиц влияют на презентацию антигена и иммунные ответы, все еще изучается.

    По сравнению с традиционными инактивированными или живыми аттенуированными вакцинами против гриппа, иммунный ответ, вызванный вакцинами на основе M2e, не мог предотвратить инфекцию гриппа (Heinen et al., 2002). Мыши, иммунизированные наночастицами M2e-Q11 или пептидом M2e с алюминиевым адъювантом, все еще инфицировались и проявляли такие признаки заболевания, как сбивание в кучу, взъерошенный мех и потеря веса после заражения вирусами гриппа.Однако наночастица M2e-Q11 может обеспечить перекрестную защиту и значительно снизить смертность мышей после заражения подтипами гриппа 1 или 2 группы. Защитный механизм (ы), опосредованный наночастицами M2e-Q11, все еще исследуется. Предыдущие исследования показали, что M2e-специфические антитела способствуют защите, индуцированной вакцинами на основе M2e (Deng et al., 2015; Rappazzo et al., 2016). Однако наночастицы M2e-Q11 индуцировали сравнимую защиту от вируса PR8, как пептид M2e с алюминиевым адъювантом, несмотря на то, что он индуцировал более низкие титры антител против M2e, чем пептид M2e с алюминиевым адъювантом.Кроме того, несмотря на наличие более 25% (6/23) замен аминокислот между антигеном M2e и последовательностями M2e гриппа H7N9, наночастицы M2e-Q11 по-прежнему обеспечивали полную защиту от вируса птичьего гриппа H7N9. Эти результаты показали, что наночастицы M2e-Q11 индуцируют иммунные ответы против консервативных областей домена M2e и поэтому могут быть многообещающим кандидатом для универсальной вакцины против гриппа.

    Заявление о доступности данных

    Все наборы данных, созданные для этого исследования, включены в статью / дополнительный материал.

    Заявление об этике

    Исследование на животных было рассмотрено и одобрено Комитетом по уходу и использованию животных Шанхайского клинического центра общественного здравоохранения.

    Авторские взносы

    FW, JH, QW и YZ разработали и разработали эксперименты. QW, YZ, PZ, MW, WF, JS и ZS проводили эксперименты. FW, JH, QW, YZ и JX проанализировали данные. Рукопись написали FW, JH, QW и YZ. Все авторы внесли свой вклад в статью и одобрили представленную версию.

    Финансирование

    Эта работа была поддержана Национальными мегапроектами Китая по основным инфекционным заболеваниям (2018ZX10301403 — FW и 2017ZX10202102 — JH), Национальным фондом естественных наук Китая (31771008 — JH), Программой сотни талантов Шанхайской муниципальной комиссии здравоохранения (2018BR08 — JH). , Китайская академия медицинских наук (2019PT350002 — JH) и гранты Шанхайского клинического центра общественного здравоохранения (KY-GW-2018-07 — QW и KY-GW-2018-15 — YZ).

    Конфликт интересов

    Авторы заявляют, что исследование проводилось при отсутствии каких-либо коммерческих или финансовых отношений, которые могут быть истолкованы как потенциальный конфликт интересов.

    Благодарности

    Мы благодарим доктора Вэйшань Хуанга из Департамента патобиологических наук Школы ветеринарной медицины Университета штата Луизиана за рецензирование рукописи и докторов Минь Луо и Кайюэ Ву из Университета Фудань за анализ распределения наночастиц по размерам.

    Список литературы

    Аль-Халифа, С., Готье, Л., Арпен, Д., Бурго, С., и Аршамбо, Д. (2019). Вакцины на основе наночастиц против респираторных вирусов. Фронт.Иммунол. 10:22. DOI: 10.3389 / fimmu.2019.00022

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Auladell, M., Jia, X., Hensen, L., Chua, B., Fox, A., Nguyen, T.H.O., et al. (2019). Вспоминая будущее: иммунологическая память на непредсказуемые вирусы гриппа. Фронт. Иммунол. 10: 1400. DOI: 10.3389 / fimmu.2019.01400

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Азми, Ф., Ахмад Фуад, А. А., Гиддам, А.K., Batzloff, M.R., Good, M.F., Skwarczynski, M., et al. (2014). Самоадъювантная вакцина против стрептококка группы А: применение фибриллированного пептида и иммуностимулирующего липида в качестве адъюванта. Bioorg. Med. Chem. 22, 6401–6408. DOI: 10.1016 / j.bmc.2014.09.042

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Барр, И.Г., Донис, Р.О., Кац, Дж. М., Маккаули, Дж. У., Одагири, Т., Трушейм, Х., и др. (2018). Вакцины против гриппа на основе клеточных культур в суровом эпидемическом сезоне 2017-2018 гг .: шаг к повышению эффективности вакцины против гриппа. Вакцины NPJ 3:44.

    Google Scholar

    Белонгиа, Э. А., Симпсон, М. Д., Кинг, Дж. П., Сундарам, М. Э., Келли, Н. С., Остерхольм, М. Т. и др. (2016). Различная эффективность противогриппозной вакцины по подтипу: систематический обзор и метаанализ исследований с отрицательным дизайном. Ланцетная инфекция. Дис. 16, 942–951. DOI: 10.1016 / s1473-3099 (16) 00129-8

    CrossRef Полный текст | Google Scholar

    Катон, А. Дж., Браунли, Г. Г., Юделл, Дж.В. и Герхард В. (1982). Антигенная структура гемагглютинина вируса гриппа A / PR / 8/34 (подтип h2). Cell 31, 417–427. DOI: 10.1016 / 0092-8674 (82) -0

    CrossRef Полный текст | Google Scholar

    Чен, Дж., Помпано, Р. Р., Сантьяго, Ф. У., Майлат, Л., Скиаммас, Р., Сан, Т. и др. (2013). Использование самоадъювантных вакцин из нановолокон для индукции высокоаффинных В-клеточных ответов на пептидные антигены без воспаления. Биоматериалы 34, 8776–8785.DOI: 10.1016 / j.biomaterials.2013.07.063

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Эстрада, Л. Д., и Шульц-Черри, С. (2019). Разработка универсальной вакцины против гриппа. J. Immunol. 202, 392–398.

    Google Scholar

    Хайнен П. П., Рийзевик Ф. А., Де Бур-Луйтце Э. А. и Бианки А. Т. Дж. (2002). Вакцинация свиней конструкцией ДНК, экспрессирующей слитый белок M2-нуклеопротеин вируса гриппа, обостряет заболевание после заражения вирусом гриппа А. J. Gen. Virol. 83, 1851–1859. DOI: 10.1099 / 0022-1317-83-8-1851

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Илюшина, Н. А., Комацу, Т. Е., Инс, В. Л., Дональдсон, Э. Ф., Ли, Н., О’реар, Дж. Дж. И др. (2019). Мутации гемагглютинина вируса гриппа A, связанные с использованием ингибиторов нейраминидазы, коррелируют со снижением ингибирования антителами против гриппа. Virol. J. 16: 149.

    Google Scholar

    Егерленер, А., Визель, М., Дитмайер, К., Забель, Ф., Гатто, Д., Саудан, П. и др. (2010). Индуцированное носителем эпитопное подавление ответов антител, вызванных вирусоподобными частицами, представляет собой динамическое явление, вызываемое специфичными для носителя антителами. Vaccine 28, 5503–5512. DOI: 10.1016 / j.vaccine.2010.02.103

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Колпе, А., Шепенс, Б., Фирс, В., и Селенс, X. (2017). Вакцины против гриппа на основе M2: последние достижения и клинический потенциал. Expert Rev. Vaccines 16, 123–136. DOI: 10.1080 / 14760584.2017.1240041

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Краммер Ф. и Палезе П. (2015). Достижения в разработке вакцин против вируса гриппа. Нац. Rev. Drug Discov. 14, 167–182.

    Google Scholar

    Лю В., Цзоу П. и Чен Ю. Х. (2004). Моноклональные антитела, распознающие эпитоп EVETPIRN белка M2 вируса гриппа А., могут защитить мышей от заражения вирусом летального гриппа А. Immunol. Lett. 93, 131–136. DOI: 10.1016 / j.imlet.2004.03.003

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Меженская Д., Исакова-Сивак И., Руденко Л. (2019). Универсальные противогриппозные вакцины на основе M2e: исторический обзор и новые подходы к разработке. J. Biomed. Sci. 26:76.

    Google Scholar

    Рамос, Э. Л., Митчем, Дж. Л., Коллер, Т. Д., Бонавиа, А., Уснер, Д. В., Баларатнам, Г. и др. (2015).Эффективность и безопасность лечения моноклональным антителом против m2e при экспериментальном гриппе человека. J. Infect. Дис. 211, 1038–1044. DOI: 10.1093 / infdis / jiu539

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Раппаццо, К. Г., Уоткинс, Х. К., Гуарино, К. М., Чау, А., Лопес, Дж. Л., Делиса, М. П. и др. (2016). Рекомбинантные вакцины везикул внешней мембраны M2e защищают мышей BALB / c от заражения летальным гриппом A. Vaccine 34, 1252–1258.DOI: 10.1016 / j.vaccine.2016.01.028

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Рудра, Дж. С., Мишра, С., Чонг, А. С., Митчелл, Р. А., Нардин, Э. Х., Нуссенцвейг, В. и др. (2012a). Самособирающиеся пептидные нановолокна, вызывающие стойкие реакции антител против эпитопа малярии. Биоматериалы 33, 6476–6484. DOI: 10.1016 / j.biomaterials.2012.05.041

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Рудра, Дж. С., Сан, Т., Берд К. К., Дэниэлс М. Д., Гасиоровски Дж. З., Чонг А. С. и др. (2012b). Модуляция адаптивных иммунных ответов на самосборку пептидов. САУ Nano. 6, 1557–1564. DOI: 10.1021 / nn204530r

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Рудра, Дж. С., Тиан, Ю. Ф., Юнг, Дж. П., и Коллиер, Дж. Х. (2010). Самособирающийся пептид, действующий как иммунный адъювант. Proc. Natl. Акад. Sci. США 107, 622–627. DOI: 10.1073 / pnas.04107

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Si, Y., Вен, Ю., Келли, С. Х., Чонг, А. С., и Коллиер, Дж. Х. (2018). Интраназальная доставка нановолокон пептидов, свободных от адъювантов, вызывает ответы резидентных CD8 (+) Т-клеток. J. Control. Выпуск 282, 120–130. DOI: 10.1016 / j.jconrel.2018.04.031

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Стивенсон И., Николсон К. Г., Вуд Дж. М., Замбон М. К. и Кац Дж. М. (2004). Противодействие угрозе птичьего гриппа: разработка вакцины от потенциальной пандемии. Ланцетная инфекция. Дис. 4, 499–509. DOI: 10.1016 / s1473-3099 (04) 01105-3

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Терли, К. Б., Рупп, Р. Э., Джонсон, К., Тейлор, Д. Н., Вольфсон, Дж., Тасси, Л. и др. (2011). Безопасность и иммуногенность рекомбинантной вакцины против гриппа M2e-флагеллина (STF2.4xM2e) у здоровых взрослых. Vaccine 29, 5145–5152. DOI: 10.1016 / j.vaccine.2011.05.041

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Ву, Ф., Хуанг, Дж. Х., Юань, X. Y., Хуанг, В. С., и Чен, Ю. Х. (2007). Характеристика иммунитета, индуцированного M2e вируса гриппа. Vaccine 25, 8868–8873. DOI: 10.1016 / j.vaccine.2007.09.056

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Zebedee, S. L., and Lamb, R.A. (1988). Белок M2 вируса гриппа A: ограничение роста вируса моноклональными антителами и обнаружение M2 в вирионах. J. Virol. 62, 2762–2772. DOI: 10.1128 / jvi.62.8.2762-2772.1988

    PubMed Аннотация | CrossRef Полный текст | Google Scholar

    Чжоу, Дж., Ван, Д., Гао, Р., Чжао, Б., Сун, Дж., Ци, X., et al. (2013).

    Добавить комментарий

    Ваш адрес email не будет опубликован.